SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g31920.1|PACid:21942479 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g31920.1|PACid:21942479
Domain Number 1 Region: 267-657
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.07e-98
Family Regulator of chromosome condensation RCC1 0.00069
Further Details:      
 
Domain Number 2 Region: 19-127
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-26
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 3 Region: 656-725
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.11e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g31920.1|PACid:21942479
Domain Number - Region: 869-932
Classification Level Classification E-value
Superfamily Tropomyosin 0.0366
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g31920.1|PACid:21942479
Sequence length 1086
Sequence
MSDASSDLGGARPGAVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFS
GKEEKQLRLSHVSRIIPGQRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWF
AGLKTLITRSHQRKWRTESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGVENYR
LRSPFGSPPKVGLEKAFSDIVSYAAPPKPFFPSDSNAGSVHSVSSGQSDNTNLHSRGIPM
DAFRVSLSSAVSSSSHGSGHDDGDALGDVFIWGEGTGEGILGGGNSRVGNSSGVNMDCLI
PKPLEFAVKLDVQNISCGGRHATLVTKQGEIYSWGEESGGRLGHGVDCDVPQPKLIDALA
NMNIELVACGEYHTCAVTLSGDLYTWGNGTSNSGLLGHGNEVSHWVPKRVNGPLEGIHVS
AISCGPWHTAIVTSAGQLFTFGDGSFGVLGHGDRQSLSVPREVESLKGLRTVRAACGVWH
TAAVVEVMVGNSSSSNCSSGKIFTWGDGDKGRLGHGDKDTRLVPTCVAALVEPNFCQIAC
GHCMTVALTTSGHVYTMGSPVYGQLGNPQADGMLPVRVEGKLHKNFVEEISCGAYHVAVL
TSRTEVYTWGKGANGRLGHGDTDDRSSPTLVEALKDKQVRTVVCGINFTAAICIHKWVSG
VDQSMCSGCRLPFNLRRKRHNCYNCALVFCHACSSKKSLKASLAPNPNKPYRVCDSCYSK
LNKGPETDRYSSAKRGSVIQGFNDSVDEELETKSNAQLSRLSSLESFKHMDSRTSKKNKK
FEFNSSRVSPIPNGSSHWSGLNISKSFGSSKKFFSASVPGSRIVSRATSPVSRRASPPRS
TTPTPTLGGLTSPRVVDGVKPNDSISQEVLSLRSQVENLTRKSQLLEADLERTTKQLKEA
ISIAGEETAKCKAAKEVIKSLTAQLKGMAEKLPEGAGLVKNSRLPPLPGISIPTDISVAS
ESLGSPRSSGEPCSNGSNGLLVSNGPTSVRNKLSHPEIPKNGTRLPDSDSKHESEWVEQD
EPGVYITLTALPGGTRDLKRVRFSRKRFSETQAEQWWQENRARVYEQYNVRVVDKSVGSI
DNDVHH
Download sequence
Identical sequences Q0DIJ3
LOC_Os05g31920.1|13105.m03280|protein LOC_Os05g31920.2|13105.m03281|protein 39947.LOC_Os05g31920.2 LOC_Os05g31920.1|PACid:21942479 LOC_Os05g31920.2|PACid:21942480 XP_015639716.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]