SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g02590.1|PACid:21933862 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g02590.1|PACid:21933862
Domain Number 1 Region: 202-320
Classification Level Classification E-value
Superfamily Bet v1-like 3.43e-19
Family STAR domain 0.0094
Further Details:      
 
Domain Number 2 Region: 17-127
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000588
Family Phosphotyrosine-binding domain (PTB) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g02590.1|PACid:21933862
Sequence length 653
Sequence
MARSGELPKVSAAATAAVRHEGWMLRYGRRKIGRSFVRTRYFVLDNKLLAYYKKQPKDNM
VPVKALQIDGNCRVEDRGLKTHHGQMVYVLCIYNKKEKENHITMGAHDIEDALVWKKKLE
LLIDQQQDTMTAKNRKAFASLDFDMEFGGPLSFSDRDSGQALLIRYMIGPRSLILGCQIR
MTPTMLTQERTGGYLDVRMARSCSRAMRAVGVVEATCESIFGLIMSMDVTRYEWDCSFQY
GSLVEEVDVVLFRSTEHQNCGPQPGFVRAFIESGGFKISPLKCVNGRPRTQVQHLMQIDL
KGWGVNYFSSFQYYSLLQMLNCVAGLREYFSQTDDIHPVPRIPVMSTMATVSKLKKDKKL
QETDLKTKQADFGQVDNKNLDMIDEESEEDDDYQVPEANLEEAPTRSDSDAKYTDPIDLS
CFSGIIRRDANEKSRNCWTVPDSKLFKVRSESFPHDKSKVPATKYLMELVAIDWLRDIKR
MDHVARRKGCAAQVAAEKGMFTFVVNIQIPGSSHYSLVLYFVTRTLEKGSLLQRFADGDD
DFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYMRGQEYIEVDVDIGSSAVANG
VLGLVFGVVTTLIVDMAFLIQANTYDELPEQLLGAARLSNIEPSSAIVPVLDK
Download sequence
Identical sequences 39947.LOC_Os06g02590.1 LOC_Os06g02590.1|13106.m00190|protein LOC_Os06g02590.1|PACid:21933862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]