SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g04550.1|PACid:21902277 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g04550.1|PACid:21902277
Domain Number 1 Region: 26-131
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-17
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g04550.1|PACid:21902277
Domain Number - Region: 205-262
Classification Level Classification E-value
Superfamily Peptide deformylase 0.0589
Family Peptide deformylase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g04550.1|PACid:21902277
Sequence length 484
Sequence
MASSGSSTVVGEMESSLERVRRQLSSTSSRHLLQGPLLKRSDTLRKWNERWVILDPATGK
MEYKIRRSDAAVRGIIVFDSTSTVTLSPMNFHGLPKYDGCCFYIGTPQKKEYFLCAETPS
AARAWVSTLHASQLVLQAHKEAVNSLGGNGPTKLGKVATVVAVANATAIEASKEVEAAMK
VSLRAALGSTTNKLSKGQLDDLTIMMETLRVKDDELHQLLQDIRARDATIREITDKLQET
AEAAETAASAAHSIDEQRRFLSSELERLKQDQEKQIEFSLLRLRESEEKAKLLSEEREHL
LKERDSALQEAQMWRSELGKARGNAVILEAAVVRAEEKARVSAADADMRINDAASRLDSA
TKEKEELVALVDALQLQIRSQDTSTKQVCEERSELCSTSSKHVDMEDDNVDKACLSDTDP
IPITENIVDLDDDGVDIPTIGVTEWNNPHSSEVSDVREVTTEPEDNSLDIPVDSQPVSEN
AFHG
Download sequence
Identical sequences B8B743 Q6ZE09
LOC_Os07g04550.1|PACid:21902277 LOC_Os07g04550.1|13107.m00395|protein XP_015646512.1.37577 39947.LOC_Os07g04550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]