SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g40404.1|PACid:21900752 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g40404.1|PACid:21900752
Domain Number 1 Region: 188-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000101
Family Nitrogenase iron protein-like 0.0024
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g40404.1|PACid:21900752
Domain Number - Region: 9-60
Classification Level Classification E-value
Superfamily PH domain-like 0.00221
Family Dcp1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g40404.1|PACid:21900752
Sequence length 752
Sequence
MDAEGTRLLNLTVLQRLDPAVKDILTSTSTNEDLIASGVVLSSRNTQPRFQFIVMNRRNR
RARPRPAARPAPRQGEHGGRWLRRPRRHARAGELVGHRTRPGVVARPPRRVPAGALPPRR
RQLRRRSGRARAALRAAAVRVRAADLSGDQPGEEDGGAGRGELAAGVRVAAEDVSMEELV
GLSTRRKLVNYILSAQHGKRIAVVLNEFREEIGLERAMINKGQGGALVEEWVELANGYVC
CTVKHSLVQALEQLVQTKESSSGNTKNLIQNFDALTCVIDAKAFRLQIDEHKKSSSFPEA
FHQIAFSDVVILNKVDLVEDNLEDLERQILEVNALVTVVQSVRCQVDLNKVFDQQAYGAK
AINFITKALLVQHEKLVLNSSQLQELLEYSKSVPPNPVFLPCAFVSKDPVSLAKTKFVFA
STFVTSTLGYSVAIAYSLSGRAAKMSLIRPRPDHVAGTPTNFHGPDRWETGDDPDYASTW
LQFTPVIFFHIAIIGHLCLKRPRDVFQLTKGSPKQKDLLHRKKKQREGNEGGDKENKDAE
ANKEEDDEEEGEEEEEKAKVKKSKTKLVHTPNPPSPLRPPPHLSSPFQRTPSARPTFSLP
CTAMTPLPGPLNRIPSNTFMASATRLFLNNVTTISLYAVAAGSSPRLSIPFHTLQACKRQ
RTSPRGSILRPAARSTSRSATRRTPVPVLGLLDHLLGDIGHLADGADDVGDEGPKSAHDA
SHINSRAREDYRTEQNRQRRRLASRQLDERRP
Download sequence
Identical sequences LOC_Os07g40404.1|13107.m04198|protein 39947.LOC_Os07g40404.1 LOC_Os07g40404.1|PACid:21900752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]