SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g32920.1|PACid:21890555 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g32920.1|PACid:21890555
Domain Number 1 Region: 37-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.09e-33
Family G proteins 0.00058
Further Details:      
 
Domain Number 2 Region: 554-675
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-18
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g32920.1|PACid:21890555
Domain Number - Region: 404-491
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0715
Family Extended AAA-ATPase domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g32920.1|PACid:21890555
Sequence length 767
Sequence
MEAIEELSELADATRQASALLADDDPSEQPAQRRGGSSFLTVVALGNIGAGKSAVLNGLI
GHPVLPTGENGATRAPICVDLQRDASLSSKSIMLQIDSKSQQVSASSLRHSLQDRLTKAG
SFGKGRSEEINVKLCTSTAPPLKLIDLPGIDQRSMDESMIGNYAARNDAILLVIVPALQA
PDVASSRALRIARELDSEGSRTIGVVSKVDQVAEDQRALLAVQALLVNQGPRTAADIQWI
ATIGNSVPIASVQSGVGSESSPETIWKVEVESLKSILLGSPQSKLGREALVDSLAKQIRT
RIKVRLPNLLNGLQGKSQIIQEELAKLGEQMVQSSEGTRVIALGLCREFEDKFLQHITGV
EGGGWKVVASFEGKFPTRIKQLPLDKHFDMKNVKRIVLEADGYQPYLISPEKGLRSLIKG
LLELAKEPSILLVDEVHRVLLDIVSATANATPGLGRYPLFKREVIAIGSAALDGFKDEAK
KMVIALVDMERAFVPPQHFIRLLQRRMERQRHEDELKSRSTKKVSDAEPSKATSPQTQTK
EGSNLQVLGPAGEITAGFLFKKRAKANDWSNRWFVLNERSGKLGYTKKQEERHFRGVINL
EECNLEEVLDEEDPTRSLKDPKKPNVPDIGTPGLIFKITHKVAYKNVLKAHKAIILKAES
MAEKTEWVTKIRSIVDQKGASATSGLPMKQSHSDGSLMSTSKKDGSLDTMLRKPVDPEEE
LKWISQEVRGYVEAVLSSLAANVPNRLWFFAKLRRQRKACLISSILR
Download sequence
Identical sequences 39947.LOC_Os08g32920.1 LOC_Os08g32920.1|13108.m03422|protein LOC_Os08g32920.1|PACid:21890555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]