SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g44260.2|PACid:21887703 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g44260.2|PACid:21887703
Domain Number 1 Region: 192-363,390-476,519-528
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.01e-83
Family Myotubularin-like phosphatases 0.00000114
Further Details:      
 
Domain Number 2 Region: 32-154
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-18
Family GRAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g44260.2|PACid:21887703
Sequence length 539
Sequence
MDGSGSWDAIDWNQIKEPRPPRSSSRGMEDFLLEDEEVYAQGHGVVLLNTDEAGILSVTN
FRLLFVSQATKGVIELGTIPLTAIEKINDDVKLQPLPRQHDKKQPRELLQVIGKDMRVIV
FDFLPKTKQKNEVFDALRRYSKPTHLWDLYAFSCDPSTVYQKSDPKMRLLKEYHRLFRKW
FPHSGSEFEKDLRNEWWRVSKVNSTYSLCSTYPSALIVPRSISDEDLLQASSFRSGRRLP
VISWCDPGSGAVLARSSQPLVGLMMNFRNNTDEKLVSALCTQIIDATGSLRKLYIVDARP
RANALANGAKGGGSESASNYPRSEVLFLGIQNIHTMRDSLFRLRDYVDTHGSVSSNGTSS
AVSLVGDRRNRGSTWGGGNLNSMTQFSSMLGEWLNHIQSIMVGASWIAAQIVQESASVLV
HCSDGWDRTTQLVALACLLLDPYYRTFNGFQALVEKDWLAFGHPFAERMGVPTITDNNSG
SQFELLRQPSLGTLSNSPNRGALGSSVSTSNTTSGQSQTSNNSSPILLQVIYSFLGALC
Download sequence
Identical sequences Q0J3S3
LOC_Os08g44260.2|PACid:21887703 LOC_Os08g44260.2|13108.m04798|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]