SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g33800.1|PACid:21926748 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g33800.1|PACid:21926748
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-19
Family GRAM domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g33800.1|PACid:21926748
Sequence length 206
Sequence
MAENPQLFGNGMLVPFYGEMFVLARDGVEFHVDKIPSAPGGHAKTKGTIYLSNIRMVFVA
SKPVGNFFAFDMPLLYVHGEKFNQPIFHCNNISGFVEPVVPENQNRALYSTHTFKILFKE
GGCGTFVPLFLNLVASVRRYNQFEAQSAASMAPRVDPLQAVQTPVDDMMRHAYVDPNDPT
KIFLQQPAPESQLRRRNYHGRADNAY
Download sequence
Identical sequences Q69IN9
XP_015651216.1.37577 39947.LOC_Os09g33800.1 LOC_Os09g33800.1|PACid:21926748 LOC_Os09g33800.1|13109.m03370|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]