SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g08879.3|PACid:21885317 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os10g08879.3|PACid:21885317
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily PH domain-like 0.000902
Family VPS36 N-terminal domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g08879.3|PACid:21885317
Sequence length 144
Sequence
MVLGLYAFADIAADGAPHLNSAAGEELVRVERAAAVALGSRAPEPPGTLFITTRRVIWVS
EVEKGKAYAVDFLAVSLHAVSRDPEAYSSPCIYTQIETEDGSDEESDESDSEVNVETELS
KVTEMRIIPSDPCQCILFTVNCLM
Download sequence
Identical sequences LOC_Os10g08879.3|13110.m00776|protein LOC_Os10g08879.3|PACid:21885317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]