SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g21406.1|PACid:21882897 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g21406.1|PACid:21882897
Domain Number 1 Region: 5-68
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.23e-16
Family 7-Fe ferredoxin 0.0000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g21406.1|PACid:21882897
Sequence length 81
Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DFLSVRVYLGPETTRSMALSY
Download sequence
Identical sequences A0A024BLG7 A0A024GW67 A0A059Q7I6 A0A059Q9N3 A0A059SPX1 A0A059U6V2 A0A075BAX1 A0A075BB48 A0A075BBI0 A0A075BBR5 A0A075BBV8 A0A075BC10 A0A075BC14 A0A075BCC3 A0A075BCG4 A0A075BCQ2 A0A075BCZ4 A0A075BDI9 A0A075BE12 A0A075BEH2 A0A075DKQ6 A0A075DKY1 A0A075DZ64 A0A075E190 A0A075VW04 A0A075VZ17 A0A075VZ37 A0A075VZP3 A0A075VZR5 A0A075W0B6 A0A075W0W3 A0A075W186 A0A075W2T1 A0A089N121 A0A089N242 A0A089N2T5 A0A089N319 A0A089N3Q4 A0A089N6G6 A0A089PEH3 A0A097PDP7 A0A0A8IBM8 A0A0A8IBY5 A0A0A8K858 A0A0A8YFK0 A0A0F6NH33 A0A0F6NH52 A0A0F6NMD3 A0A0F6NMX1 A0A0F6NMY7 A0A0F6NN49 A0A0F6NNB2 A0A0F6NNB5 A0A0F6NNK0 A0A0F6NP39 A0A0F6NPE9 A0A0F6NPG1 A0A0F6NPM2 A0A0F6NPP8 A0A0F6NQ33 A0A0F6NQA6 A0A0F6NQM6 A0A0F6NQV8 A0A0F6QKK9 A0A0F7LE90 A0A0H3V738 A0A0H3V7H5 A0A0H3V7V3 A0A0H3VAF7 A0A0H3VWN2 A0A0H3VXH9 A0A0H3VYD0 A0A0H3VZ00 A0A0H3VZ50 A0A0K0LL65 A0A0K0LMX4 A0A0K0LRH9 A0A0K0MED1 A0A0M4B2K1 A0A0M4B3Q2 A0A0M5IF11 A0A0N9E0W4 A0A0N9E110 A0A0P0FDP0 A0A0S1S2Y5 A0A0S2RKY6 A0A0S2RLN8 A0A0S2RM57 A0A0S2RMG0 A0A0U1WPK2 A0A0U1WPQ2 A0A0U2KDE5 A0A0U2VYP2 A0A0U2ZQS6 A0A0U3BIL3 A0A0X8D9K4 A0A120HX73 A0A126KBJ5 A0A126KBV0 A0A126KBZ1 A0A126KCF8 A0A126KCH7 A0A126KD09 A0A126KD18 A0A126KDG6 A0A139Z7T7 A0A140GZ74 A0A141NXP1 A0A141NXX6 A0A141NY61 A0A141NYE4 A0A141NYM8 A0A141NYW2 A0A142G5Y2 A0A142K0Z7 A0A142K181 A0A142K1G6 A0A142K1Q1 A0A142K1Y6 A0A142K270 A0A159BII9 A0A159BJ02 A0A161CHF6 A0A162I6L8 A0A172FJA2 A0A172FJJ4 A0A172FJS9 A0A172FJZ8 A0A172GFL5 A0A193D2V8 A0A193D3J0 A0A193D3K4 A0A193D426 A0A193D4D9 A0A193D4R5 A0A193D4S5 A0A193D505 A0A193D596 A0A193D5L6 A0A193D5X2 A0A193D605 A0A193D644 A0A193D6H0 A0A193D6U6 A0A193D737 A0A193D766 A0A193D7N2 A0A193D804 A0A193D8A7 A0A193D8D4 A0A193D8G4 A0A193D8T3 A0A193D9A5 A0A193D9F0 A0A193D9L3 A0A193D9L7 A0A193DAI3 A0A193DAK3 A0A193DAR0 A0A193DAU6 A0A1B1FCM9 A0A1B1FCZ0 A0A1B1FD31 A0A1B1FDG1 A0A1B1JBL2 A0A1B1JBW3 A0A1B1Q691 A0A1B1UUW8 A0A1B1YZ29 A0A1B2URF4 A0A1B3TNI4 A0A1B3TNI5 A0A1B3TNI6 A0A1B3TNI8 A0A1B3TNI9 A0A1B3TNJ0 A0A1B3TNJ1 A0A1B3TNJ2 A0A1B3TNJ3 A0A1B3TNJ4 A0A1B3TNJ5 A0A1B3TNJ6 A0A1B3TNJ7 A0A1B3TNJ8 A0A1B3TNK0 A0A1B3TNK2 A0A1B3TNK3 A0A1B3TNK8 A0A1B3TNK9 A0A1B4XTH2 A0A1B4XU30 A0A1C9IAT5 A0A1D8KWR8 A0A1J0MNT4 A0A1J0MP54 A0A1J0MQT1 A0A1L3TJY8 A0A1L3TK87 A0A1L4AI52 A0A1P8C5E6 A0A1P8C5S1 A0A1P8C5U7 A0A1P8D7K4 A0A1P8D7T3 A0A1Q1MNW0 A0A1S6M1X3 A0A1S6Q6A0 A0A1W5HNN2 A0A1W5HPK1 A0A1W5HPL1 A0A1W5HPZ5 A0A1W5HQB6 A0A1W5HQM5 A0A1W5HRZ4 A0A1W5HSG9 A0A1W5HUJ1 A0A1W5HX38 A0A1W5I229 A0A1W5PRV0 A0A1W6AZW5 A0A1W6GX70 A0A1W6Q5T7 A0A1X9IGR5 A0A1Y0ACG9 A0A1Y0AD92 A0A1Y0AEJ6 A0A1Y0AGJ2 A0A1Y0AI57 A0A1Y0AIA2 A0A1Y0AII2 A0A1Y0AJ16 A0A1Y0AJE2 A0A1Y0AJI5 A0A1Y0AK01 A0A1Y0AKL6 A0A1Y0AKL7 A0A1Y0AKX1 A0A1Y0ALT1 A0A1Y0AMG7 A0A1Y0AN10 A0A1Y0AN21 A0A1Y0APA9 A0A1Y0APL6 A0A1Y0APP7 A0A1Y0APT9 A0A1Y0APU7 A0A1Y0AQN8 A0A1Y0AQS0 A0A1Y0AQS2 A0A1Y0ARC7 A0A1Y0ARG3 A0A1Y0AS71 A0A1Y0ASF0 A0A1Y0ASL5 A0A1Y0ASN6 A0A1Y0ATE4 A0A1Z3MIX9 A0A1Z3MJM3 A0A1Z3MKA8 A0A1Z5AYC2 A0A218L6H5 A0A218L753 A0A218L7S4 A0A218LAA7 A0A218LDJ6 A0A218LEJ4 A0A218LES5 A0A218LF23 A0A218LFN3 A0A218LGE1 A0A218LHI8 A0A218LIZ4 A0A218LJ40 A0A218LK37 A0A218LKZ6 A0A218LLF3 A0A218LME6 A0A218LMV8 A0A218LMW6 A0A218LMZ3 A0A218LNC8 A0A218LNS2 A0A218LPM0 A0A218LQ53 A0A218LQZ8 A0A218LR13 A0A218LRL4 A0A218LTM6 A0A218LU53 A0A218LVK6 A0A220IIS4 A0A220IPB2 A0A220NDA7 A0A220NDI3 A0A220NDQ4 A0A220NE01 A0A220NED3 A0A220NEW6 A0A220NF55 A0A220NFF5 A0A220NFZ3 A0A220NG44 A0A220NGB7 A0A220NGS5 A0A220NH19 A0A220NHU7 A0A220NI10 A0A220NJ64 A0A220NJK2 A0A220NKE4 A0A220VXP0 A0A222YTQ7 A0A224L1A2 A0A224L317 A0A224L478 A0A224L580 A0A224L5P8 A0A224L5T8 A0A224L697 A0A291HWY7 A0A291HXE7 A0A291HXV3 A0A291HY37 A0A291HYM8 A0A291HYT1 A0A291HZ18 A0A291HZ84 A0A291HZJ3 A0A291HZT0 A0A291HZY8 A0A291I071 A0A291I0F1 A0A291I0R8 A0A291I143 A0A291I1F0 A0A291PQT8 A0A291PR03 A0A2D2AK28 A0A2D3HJT1 A0A2H4HJV2 A0A2H4HK52 A0A2H4HKC0 A0A2H4HKJ9 A0A2H4HKT5 A0A2H4HL18 A0A2H4HLB2 A0A2H4HLJ3 A0A2H4HM22 A0A2H4HM86 A0A2H4HMQ6 A0A2H4HN20 A0A2H4HN72 A0A2H4HNF0 A0A2H4HNX1 A0A2H4HPE6 A0A2H4HQ77 A0A2H4HQF5 A0A2H4HQV1 A0A2H4HR41 A0A2H4HRC8 A0A2H4HRK1 A0A2H4HRU8 A0A2H4HS18 A0A2H4HS97 A0A2H4HSJ0 A0A2I2MTJ9 A0A2I2MTS3 A0A2I4R1W9 A0A2I6C0J3 A0A2I6IWD4 A0A2I6IWJ9 A0A2I6IX10 A0A2I6IXI2 A0A2I6IXS6 A0A2I6IY01 A0A2I6IY85 A0A2I6IYG5 A0A2I6IYQ3 A0A2I6IYY3 A0A2I6IZ60 A0A2I6IZF4 A0A2I6PNY6 A0A2K4MWG9 A0A2K4N4Z5 A1EA60 A1YV22 A1YV23 A1YV24 A1YV25 A1YV26 A1YV27 A1YV28 A1YV29 A1YV30 A1YV32 A8Y9D8 B3TNA0 C6GJA6 C7BFC4 C7SM09 D5HQL2 E2GJU1 E9KIT0 E9KIZ8 E9KJ66 E9KJD3 E9KJJ9 F8RS53 F8RXG0 F8RXP3 F8RXU9 F8RY59 F8RYE3 F8S8A8 G3EFH9 G9HXW0 G9HY43 G9HYC6 H6CSX4 H6SZI1 H6SZI8 H6SZI9 H6SZJ1 H6SZJ6 H6SZK2 H6SZK4 H6SZK8 H6SZK9 H6SZL0 H6SZL3 H6SZL4 H6SZL6 I1Q6F0 J3RG68 K4P9W0 K4PA67 K4PC80 K4PML6 L7TSW5 M1JZ75 M7ZRG7 P0C359 P0C360 P0C361 P69415 P69416 Q4FFK4 Q6ENA6 Q6ENP6 Q6L3D9 R4HFY1 S4S7R3 S4SDB0 S4YZ47 S4YZY7 S4Z359 S4Z954 U5TXE2 V5N4G3 V9MFU6 V9PDX0 W5ZP82 X2CC46 X2CCF2
Traes_1DL_3A92B17F0.1 Traes_2DS_3A92B17F0.1 Traes_6BS_3A92B17F0.1 Traes_6DL_3A92B17F0.1 39947.LOC_Os06g46436.1 39947.LOC_Os07g22498.1 39947.LOC_Os10g21406.1 39947.LOC_Osp1g00920.1 NP_039445.1.37577 YP_002000536.1.954 YP_008474354.1.58150 YP_008815801.1.39314 YP_009116393.1.18548 LOC_Os06g46436.1|13106.m10449|protein LOC_Os07g22498.1|13107.m09929|protein LOC_Os10g21406.1|13110.m07734|protein LOC_Os06g46436.1|PACid:21931760 LOC_Os07g22498.1|PACid:21900396 LOC_Os10g21406.1|PACid:21882897 5zji_C ORGLA03G0394500.1 ORGLA06G0242500.1 ORGLA06G0259000.1 ORGLA06G0271300.1 ORGLA07G0095000.1 ORGLA08G0208200.1 ORGLA10G0159600.1 ORGLA11G0196700.1 TRIUR3_07858-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]