SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g31770.1|PACid:21883172 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g31770.1|PACid:21883172
Domain Number 1 Region: 203-373
Classification Level Classification E-value
Superfamily Bet v1-like 6.18e-40
Family STAR domain 0.0036
Further Details:      
 
Domain Number 2 Region: 4-119
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000308
Family Phosphotyrosine-binding domain (PTB) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g31770.1|PACid:21883172
Sequence length 725
Sequence
MSSSSSSVVYEGWMVRYGRRKIGRSFIHMRYFVLETRLLSYYKRKPQHKMPKLPIKSLHI
DGNCRVEDRGLKMHHGHMLYVLCVYNKREKHQRITMAAFNIQEALIWKEKIEMVIDQQQG
VVASDGNLAHSSSQQKVSLENGRKSSFSDHESLYSHEEEEEEEDNQRSLMRRTTIGNGPP
ESLYDWTRENDLGISNQGSPDHVFSRRHWRLVRCQNGLRIFEELQDVDYLARSCSRAMKA
VGVVEASCEAIFQLVMSMDTTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFSMFVWP
RDLCYVRYWRRNDDGSYVVLFQSREHPNCGPQPGFVRAQIESGGFNISPLKSRNGRIRTQ
VQHLMQIDLKGWGVGYLPSFQQHCLLHMLNSVAGLREWFSQSDENLILPRIPVMANMAPP
VSSKKGRTTQDNTMQTGLQMDQSRQSTMLDEESDEDEDQIPESEQETSTHGHDAPVKLPV
LDEEDSDQIDVSGFSGNLRRDDRDNTRDCWRMSDGNNFRVRSKTFIYDKSKIPAGKPLMK
LVAVDWFKDVKRMDHVARRKGCAVQVAAEKGLFALAVNLQVPGTTNYSMVFYFVTKKLIP
NSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDITYIRGPNYLEI
DVDIGSSTVANGVLGLVCGVITTLVVDMAFLVQGNTYEELPERLIGAVRVSHIELKSAIV
PVLGD
Download sequence
Identical sequences Q337P5
LOC_Os10g31770.1|PACid:21883172 LOC_Os10g31770.1|13110.m02767|protein XP_015614658.1.37577 39947.LOC_Os10g31770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]