SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g32050.1|PACid:21884273 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g32050.1|PACid:21884273
Domain Number 1 Region: 15-118
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000202
Family Ankyrin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  LOC_Os10g32050.1|PACid:21884273
Domain Number - Region: 133-189
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0549
Family PSF3 N-terminal domain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g32050.1|PACid:21884273
Sequence length 194
Sequence
MGFCAGNGTTHLYPLAAGRLSAVIALLTIFPGSAGLRDSDGRTFVHVAARKKRYSVVAHA
CQTPALSGILNKQDNEGNTALHLAVEAGDWWIFACLFVNKQVDLNLPNSSGHTPLELSIN
TIPTGLYCLLNSRILIQETLIAANATRGISRMDAAGTEEHGPQSEAENEEKGSEIVLPLY
YILMYDAIDFLFNV
Download sequence
Identical sequences 39947.LOC_Os10g32050.1 LOC_Os10g32050.1|PACid:21884273 LOC_Os10g32050.1|13110.m02800|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]