SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g37430.1|PACid:21885681 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g37430.1|PACid:21885681
Domain Number 1 Region: 127-247
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000721
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 2 Region: 206-334
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000154
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  LOC_Os10g37430.1|PACid:21885681
Domain Number - Region: 345-456
Classification Level Classification E-value
Superfamily PH domain-like 0.000266
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g37430.1|PACid:21885681
Sequence length 472
Sequence
MKEPAQVRTARGGAADGVEVGVEEEEEPPRSATVKQEEANAVLGAEGSRPFAMRELKEDH
EVAAGSGVKAASGERNGIGSADAQGSSYSQESMQQFSSHHDVAMDLINSVTGVDEEGRSR
QRILSFAAKRYISAIERNHDDPDAYYNWALVLQESADNVDPNSSSSKDALLEEACKKYAE
ATRLCPTLYDAYYNWAIAIADRAKMRGRTKEAEELWKQAILNYEKAVQLNWNSPQALNNW
GLGLQELSAIVPAREKQTIIKTAISKFRAAIQLQFDFHRAIYNLGTVLYGLAEDTMRSGK
PGVSASEFYSQSAIYVAAAHALKPNYSVYRSALRLVRSMLPLPYLKVGYLIAPPENSAIA
PHKEWERSQFVLNHEELQQVNASDQPPSQSPGHVDSGRKLFRIVVADIVSVSACADLTLP
PGAGLRIDTIHGPRFLVADNWETIDSWLDAIRLVYTIFARGRSDVLAGIITG
Download sequence
Identical sequences Q7XCR5
39947.LOC_Os10g37430.1 XP_015614985.1.37577 LOC_Os10g37430.1|PACid:21885681 LOC_Os10g37430.1|13110.m03394|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]