SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g05650.1|PACid:21945978 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g05650.1|PACid:21945978
Domain Number 1 Region: 38-156
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-47
Family Dcp1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g05650.1|PACid:21945978
Sequence length 380
Sequence
MPPPPPPQPQPTTTATTSANGGKVTPNLTMDAEGTRLLNLTVLQRLDPAVEDILITAAHV
TLYDFNIDLNQWSRKDVEGSLFVVKRNTQPRFQFIVMNRRNTDNLVEDLLSDFEYELQPP
YLLYRNAAQEVNGIWFYNQHDCEAVASLFGRILNAYAKVPPKPKVPSTKSEFEELEAVPT
SAAIDGPLEPSPATTTIVSDAPDESLVNYFSSAASIGSVSNAPMAGRAHPSSESVATPHV
PLIIPSATPTHQIPPPLVGSSAPPLPLHDTNVHTARSANLVTPAFFTPPSSSSTSMVPPA
SSMMPTAPPLHPTSASAQRATYGTPLLQPFPPPTPPPSLTPSYNEGPIISRDKVKEALLR
LVQNDQFIDLVYRELQNAHM
Download sequence
Identical sequences I1QXT8 Q53QH1
LOC_Os11g05650.1|PACid:21945978 XP_015617840.1.37577 39947.LOC_Os11g05650.1 LOC_Os11g05650.1|13111.m00550|protein ORGLA11G0033000.1 ORGLA12G0180700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]