SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g35420.2|PACid:21946894 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os11g35420.2|PACid:21946894
Domain Number - Region: 25-69
Classification Level Classification E-value
Superfamily BEACH domain 0.0549
Family BEACH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g35420.2|PACid:21946894
Sequence length 113
Sequence
MRICVLGNSWICICCKVLHPLVLGSECRAYAYMHMHMLEGVGPLGAWIRMWFGYSPQLVF
LLICIRNSWLYRKVLSPDLWFTQNELVILRYNLSFGHEFVALSEGLHLFSLHI
Download sequence
Identical sequences I1R0Y7 Q2R2L3
LOC_Os11g35420.2|PACid:21946894 ORGLA11G0142900.1 39947.LOC_Os11g35420.2 LOC_Os11g35420.2|13111.m03451|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]