SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g39300.1|PACid:21948498 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os11g39300.1|PACid:21948498
Domain Number - Region: 78-108
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0714
Family WD40-repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g39300.1|PACid:21948498
Sequence length 145
Sequence
MASSSSPPTASWSRRCRPATAQVKRIAEDPDDRSLDKSAKVVIGGGQDAMNVTMTNCLAG
KFEPKFFHKILQEEIGVKGHFGPINVLAFNPDGWSSVIVVTFVGNIRYADHSLMMNENMR
AMLSKIKFDLLVRNLVAFLVWLFEA
Download sequence
Identical sequences A0A0E0RAQ2 Q2R1G0
39947.LOC_Os11g39300.1 LOC_Os11g39300.1|PACid:21948498 LOC_Os11g39300.1|13111.m03879|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]