SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g47170.1|PACid:21945663 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g47170.1|PACid:21945663
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-35
Family Protein kinases, catalytic subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g47170.1|PACid:21945663
Sequence length 191
Sequence
MEYLHHEHCEVVLHCDLKPSNVLFNDDMTAHVSDFGIARLLLGDDSSMISASMPGTVGYM
APEYGALGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVLQAFPANLVHVID
GQLVQDSSSSTSSIDGFLMPVFELGLLCSSDSPEQRMVMSDVVVTLKNIRKEYVKLIATM
GRDDNRTAVFH
Download sequence
Identical sequences Q53QC1
39947.LOC_Os11g47170.1 LOC_Os11g47170.1|PACid:21945663 LOC_Os11g47170.1|13111.m04675|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]