SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g06020.1|PACid:21934772 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g06020.1|PACid:21934772
Domain Number 1 Region: 30-148
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-47
Family Dcp1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g06020.1|PACid:21934772
Sequence length 374
Sequence
MRPPAPATTAGAGGKVTPNLAMDAEGTRLLNLTVLQRLDPAVEDILITAAHVTLYDFNIE
LNQWSRKDVEGSLFVVKRNKQPRFQFIVMNRRNTDNLVEDLLSDFEFELQPPYLLYRNAA
QEVNGIWFYNQQDCDAVAGVFGRILNAYAKVPPKPKVPSTKSEFEELEAVPTSAAIDGPL
EPSSSSTVLVSNAPDESLTDYFSGAVNVGNVSITPMVGRTHQPIESVASSHVPLIIPSAA
PTHQMGVPSGAASAPPLPVIDTNVHSSHSTNLVTPAFFAPPSSSSASLVAPASSFMPTAS
PFHPTSADAHRPAYGHGTPLLQPLPPPTPPASLTPVHNDEPVISRDKVKDALLRLVQNDE
FINLLYQELQNAHA
Download sequence
Identical sequences A0A0E0RE04 B8BN98 Q2QXH6
XP_015620671.1.37577 LOC_Os12g06020.1|13112.m00610|protein LOC_Os12g06020.1|PACid:21934772 39947.LOC_Os12g06020.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]