SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g35130.1|PACid:21935194 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g35130.1|PACid:21935194
Domain Number 1 Region: 525-954
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.78e-174
Family Reverse transcriptase 0.0000201
Further Details:      
 
Domain Number 2 Region: 1127-1286
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.58e-43
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 3 Region: 379-486
Classification Level Classification E-value
Superfamily Acid proteases 3.82e-16
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Domain Number 4 Region: 319-353
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000645
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Weak hits

Sequence:  LOC_Os12g35130.1|PACid:21935194
Domain Number - Region: 1398-1470
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000336
Family Chromo domain 0.018
Further Details:      
 
Domain Number - Region: 236-268
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0563
Family Ribosomal protein L29 (L29p) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g35130.1|PACid:21935194
Sequence length 1470
Sequence
MDEVGRRWTFSRANEGYTSCGPVVNTRSNGNGPNNPNNNNNEENPTLAQVLAQQTQLMNM
MMQQLQNQQNQGNNHAPPQNKLAEFLRVRPPIFSSTTNPVEAGDWLHAIEKKLDLLQCTD
QEKVSFASHQLHGPAFEWWDHFRLNRTTTEPITWLEFTAAFRKTHIPSGVVSLKKKEFRS
LTQGSRSVTEYLHEFNRLARYAPEDVRNDEERQEKFLEGLNDELSYPLMTGDYSDFQKLV
DKAIRQEDKYNRMEQKKRRIAQLKTQQGNIQKPRLTLGPQSMPQGGSSSIVRPQRQFFNN
NAGNNIRNQAPRPVAAPAQQQPVKREQGSKPVVCFNCGDPGHYADKCPKPRRVKVVPAQS
NSAVPASKARVNHVAAAEAQDAPDVILGTFLVNSVPATVLFDSGATHSFLSMSFAGNHGM
EVEDLRRPLMVSTPSNQALSLQRSPSVRIEIQGVPFRANLILLESKDLDVILGMDWLARY
KGVIDCANRKVTLTSNDGRVVTVHALSSESLRSRLNQITLEEIPIVREYPDVFPDDLPGM
PPKRDIEFRIDLVLGTTPIHKRPYRMAANELAEVKRQVDDLLQKGYIRPSSSLWGAPVIF
VEKKDHTQRMCVDYRALNDVTIKNKYPLPRIDDLFDQLKGATVFSKIDLRSGYHQLRIKE
EDIPKTAFTTRYGLFECTVMSFGLTNAPVFFMNLMNKVFMEYLDKFVVVFIDDILIYSRT
KEEHEEHFRLALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWK
QPKTVSEIRSFLGLAGYYRRFIENFSKITKPMTRLLQKDVKYKWSEECEQSFQELKNRLI
SAPILILPDPKKGFQVYCDASKLGLGCVLMQDGKVVAYASRQLRPHEKNYPTHDLELAAV
VHALKIWRHYLFGTRTEVYTDHKSLKYIFTQPDLNMRQRRWLELIKDYDMGIHYHPGKAN
VVADALSRKGYCNATEGRQLPLELCKEFERLNLGIVSRGFVAALEAKPTLIDQVRETQIN
DPDIQEIKKNMRRGKSIGFLEDEQGTVWLGERICFPDNKDLKNAILKEAHDTLYSIHPGS
TKMYQDLKERFWWASMKREIAEYVAVCDICQRVKAEHQKPAGLLQPLKIPEWKWEEIGMD
FITGLPRTSSGHDSIWVIVDRLTKVAHFIPVKTTYFGSRLAELYMARIVCLHGVPKKIVS
DRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACALDFGGSWDK
NLPYAEFSYNNSYQASLQMAPYEALYGRKCRTPLLWDQTGERQVFGTDILREAEEKVKII
QERLRVAQSRHKSYADNRRRDLSFEEGDYVYLRVTPLRGVHRFHTKGKLAPRFVGPYKIV
SRRGEVAYQLELPQSLAGVHNVFHVSQLKKCLRVPTEEANLEQIEVQEDLTYVEKPIRIL
EIDERRTRNRVIRFCKVQWSNHSEEESTWE
Download sequence
Identical sequences Q2QPA7
LOC_Os12g35130.1|13112.m03594|protein 39947.LOC_Os12g35130.1 LOC_Os12g35130.1|PACid:21935194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]