SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g41140.2|PACid:21935082 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os12g41140.2|PACid:21935082
Domain Number - Region: 262-368
Classification Level Classification E-value
Superfamily PH domain-like 0.0231
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g41140.2|PACid:21935082
Sequence length 383
Sequence
MEQQEVSPLTSGRLSHSSGPLNGGGSLSDSPPVSPDVDDSKFCRAVSTPKPQPYRGVVGG
GGKTVGRWLKERKEKKKEEARAHNAQVHAAVSVAAVAAAVAAVAAATAASGGGRDDRAAR
TDMAVASAATLVAAQCVEAAESLGAERDHLAAAIASAVNVRTPGDIVTITAAAATALRGA
ATLKARALKDVWNVAAVIPVEKNAIAAATTGGGHHKHNAQKQQHHHRHHGNGSNTSSSFS
DEVAAVDDDDDDDNNFLTICSQELLARGTELLKRTRKGALHWKVVSVYIHRTGVVMLKMK
SRHVAGTLTKKKKNVVVDVCRDVAAWPGRHLLEGGEHRRYFGLRTAEHRVIEFECGSQRE
HDMWTKGVARLLATIDGRRKRFA
Download sequence
Identical sequences H2KX61
LOC_Os12g41140.2|13112.m04290|protein LOC_Os12g41140.2|PACid:21935082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]