SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g41140.3|PACid:21935081 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os12g41140.3|PACid:21935081
Domain Number - Region: 358-464
Classification Level Classification E-value
Superfamily PH domain-like 0.0387
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g41140.3|PACid:21935081
Sequence length 479
Sequence
MSESGRVTAGGGRGELRPPELPRDPALEFLSRSWSASGAADVSRRALAAAAFPAAAASAA
VIAEDVSGELDVDGSASGSSFSFASAATSQLIMDRIMSQSEVSPLTSGRLSHSSGPLNGG
GSLSDSPPVSPDVDDSKFCRAVSTPKPQPYRGVVGGGGKTVGRWLKERKEKKKEEARAHN
AQVHAAVSVAAVAAAVAAVAAATAASGGGRDDRAARTDMAVASAATLVAAQCVEAAESLG
AERDHLAAAIASAVNVRTPGDIVTITAAAATALRGAATLKARALKDVWNVAAVIPVEKNA
IAAATTGGGHHKHNAQKQQHHHRHHGNGSNTSSSFSDEVAAVDDDDDDDNNFLTICSQEL
LARGTELLKRTRKGALHWKVVSVYIHRTGVVMLKMKSRHVAGTLTKKKKNVVVDVCRDVA
AWPGRHLLEGGEHRRYFGLRTAEHRVIEFECGSQREHDMWTKGVARLLATIDGRRKRFA
Download sequence
Identical sequences Q2QMH5
LOC_Os12g41140.3|13112.m08941|protein XP_015618656.1.37577 LOC_Os12g41140.3|PACid:21935081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]