SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g08970.1|PACid:21903226 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g08970.1|PACid:21903226
Domain Number 1 Region: 204-441
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-77
Family SSRP1-like 0.00000644
Further Details:      
 
Domain Number 2 Region: 542-624
Classification Level Classification E-value
Superfamily HMG-box 4.32e-26
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g08970.1|PACid:21903226
Sequence length 641
Sequence
MTDGHLFNNILLGGRAGSNPGQFKVYSGGLAWKRQGGGKTIEIEKSDLTSVTWMKVPRAY
QLGVRTKDGLFYKFIGFREQDVSSLTNFMQKNMGLSPDEKQLSVSGQNWGGIDINGNMLT
FMVGSKQAFEVSLADVSQTQMQGKTDVLLEFHVDDTTGGNEKDSLMDLSFHVPTSNTQFL
GDENRTAAQVLWETIMGVADVDSSEEAVVTFEGIAILTPRGRYSVELHLSFLRLQGQAND
FKIQYSSIVRLFLLPKSNNPHTFVVVTLDPPIRKGQTLYPHIVIQFETEAVVERNLALTK
EVLAEKYKDRLEESYKGLIHEVFTKVLRGLSGAKVTRPGSFRSCQDGYAVKSSLKAEDGL
LYPLEKGFFFLPKPPTLILHEEIEFVEFERHGAGGASISSHYFDLLVKLKNDQEHLFRNI
QRSEYHNLFNFINGKHLKIMNLGDGQGATGGVTAVLRDTDDDAVDPHLERIKNQAGDEES
DEEDEDFVADKDDSGSPTDDSGGEDSDASESGGEKEKLSKKEASSSKPPVKRKPKGRDEE
GSDKRKPKKKKDPNAPKRAMTPFMYFSMAERGNMKNNNPDLPTTEIAKKLGEMWQKMTGE
EKQPYIQQSQVDKKRYEKESAVYRGAAAMDVDSGSGGNESD
Download sequence
Identical sequences Q9LGR0
39947.LOC_Os01g08970.1 XP_015617055.1.37577 LOC_Os01g08970.1|13101.m00950|protein LOC_Os01g08970.1|PACid:21903226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]