SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g47600.1|PACid:21910538 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g47600.1|PACid:21910538
Domain Number 1 Region: 32-117
Classification Level Classification E-value
Superfamily HMG-box 1.96e-22
Family HMG-box 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g47600.1|PACid:21910538
Sequence length 133
Sequence
MKTRSQTAPKPLKTVRLPPVKPRPKPPPPQPQPPPSRKKGQPLVDRRRPKKPPTAFFYFM
EDFRKTYKEENPSVKSMQEVGKACGEKWNTMTFEERVKYYDIATEKRAEYEKAVAEFDKK
KESGELSEESDYD
Download sequence
Identical sequences A0A0E0C5R0 A0A0E0N0E6 A2WTJ2 I1NQG3 Q5QLQ9
OMERI01G22590.1 XP_015620110.1.37577 ORGLA01G0210300.1 39946.BGIOSIBCE003084 39947.LOC_Os01g47600.1 LOC_Os01g47600.1|13101.m04922|protein LOC_Os01g47600.1|PACid:21910538 OsIBCD002832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]