SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g63120.1|PACid:21909938 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g63120.1|PACid:21909938
Domain Number 1 Region: 551-980
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.89e-177
Family Reverse transcriptase 0.0000129
Further Details:      
 
Domain Number 2 Region: 1152-1263
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.64e-24
Family Retroviral integrase, catalytic domain 0.028
Further Details:      
 
Domain Number 3 Region: 394-497
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000176
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 
Domain Number 4 Region: 341-378
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000977
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g63120.1|PACid:21909938
Sequence length 1435
Sequence
MVYTRTGNRTAGEGSNGEERADGVHPNSDSGNGPPPLPENPTLAQVMAHQTQMMAAMMQQ
MQQQHQQMHQRMMQHAEQQHQQFGPPPPQSKLLEFLRVRPPTFSSTTNPMEANDWLHAIE
KKLNLLQCNDQEKVAFATHQLQGPASAWWDNHMATRPPGAEVTWAEFCRSFRKAQVPDGV
VAQKKREFRVLHQGNRTVTEYLHEFNRLARYAPEDVRTDAEKQEKFMAGLDDELTNQLIS
GDYADFERLVDKAIRQEDQRNKMDRKRKAAQFRSNQGSQHRPRFTPGQQGGPTTMIVRQH
RPFHSSNFHQGASGSPNHQGGQPNRGAAPRPPMAPAQPAPSAQAKKETGTKPGSCFNCGE
LGHFADKCPKPRRAGPRFIQARVNHASAEEAQAAPEVVLDTFPVNSIPATVLFDSGATHS
FISKKFVGMHGLIREELSTPMRVHTPGNSSTSVQFSPSITIEIQRSPFLANLILLESKDL
DVILGMDWLTKFKGAIDCASRTVTLTNEKGETVVYKSPDSPKQGVSLNQIETEIPVDTVE
KSLRKLEDIPIVCEYPEVFPEDLTTMPPKREIEFRIDLAPGTAAIYKRPYRMAANELAEV
KKQVDEQLQKGYIRPSTSPWGAPVIFVEKKDKTKRMCVDYRALNEVTIKNKYPLPRIDDL
FDQLKGAKVFSKIDLRSGYHQLRIREEDIPKTAFTTRYGLYECTVMSFGLTNAPAFFMNL
MNKVFMEFLDKFVVVFIDDILIYSKSEEEHEQHLRLVLEKLKEHQLYAKFSKCDFWLTEV
KFLGHVITAQGVAVDPSNVESVTKWTPPKTVSQIRSFLGLAGYYRRFIENFSRIARPMTQ
LLKKDEKFKWTAECDKSFEELKKKLVSAPVLILPDQMKDFQVYCDASRHGLGCVLMQEGR
VVAYASRQLRPHEGNYPTHDLELAAVVHALKIWRHYLIGNRCEVYTDHKSLKYIFTQPDL
NLRQRRWLELIKDYDMSIHYHLGKANVVADALSRKSYCTALCIEGMCEELRQEFEHLNVG
IVEHGFVAALEARPTLVDQVRAAQVNDPEIAELKKNMRVGKARDFLEDEHGTIWMGERLC
VPDDKELKDLILTEAHQTQYSIHPGSTKMYQDLKEKFWWVSMRREIAEFVALCDVCQRVK
AEHQRPAGLLQPLQIPEWKWEEIGMDFITGLPRTSSGHDSIWVVVDRLTKKLQEELGTRL
NFSTAYHPQTDGQTERVNQILEDMLRACALDFSGAWDRCLPYAEFSYNNSYQASLQMAPF
EALYGRKCRTPLFWDQTGERQLFGTEVLAEAEEKVRIIRERLRIAQSRQKSYADNRRREL
TFEAGDYVYLRVTPLRGVHRFQTKGKLAPRFVGPYKILERRGEVAYQLELPSNMIGIHDV
FHVSQLKKCLRVPEEQADSEHIDIQEDLTYVEKPVRILDTSERRTRNKVTRFCRV
Download sequence
Identical sequences LOC_Os01g63120.1|PACid:21909938 39947.LOC_Os01g63120.1 LOC_Os01g63120.1|13101.m06770|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]