SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g01270.1|PACid:21919802 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g01270.1|PACid:21919802
Domain Number 1 Region: 255-428
Classification Level Classification E-value
Superfamily Bet v1-like 5.49e-41
Family STAR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 70-181
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000487
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g01270.1|PACid:21919802
Sequence length 804
Sequence
MMLSSSASRREVGGGGAASSTKSGELSLSKVASVAIRESSGSGSGGISKSSELLSRAGTM
AAAREAAAAAVHHEGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKPKDNMVPLKSLL
IDGNCRVEDRGLKTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNIELIIDQQE
NMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEERPMLIRRTTIGNGPPESIHDWTK
EHDIGPPNQIDPIQVSSKKNWRLLRCQNGLRIFEELLEFDYLARSCSRAMRAVGVVEATC
EAIFGLVMSMDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRY
WRRNDDGSYVVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQID
LRGWLLNYSPSFQYHSLLQIQNCVAGLREYFSQTDETHITPRIPVMENMVDTSAVQKDDK
KSTEEVDSKTKTPDRGQADSKNMGIIDEETDEDEDYQVPEANIEEDPNKDAKRADEPPEK
IDLSCFSGILRCDADEKSRNCWTVPDSKLFKVRSKNFPHDKSKIPAASYLMELAAIDWFK
DSKRMDNVGRQKGCVAQVAAEKGMHTFVANIQIPGSTHYSLVMYFVTKSLKKGSLLQRFF
DGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYVRGAGYLEVDVDIGSSA
VANGVLGLVFGVVTTLVVDMAFLIQANTYEELPEQVIGAARLAHVEPAAAIVPQDLTPPP
PALADDDNAAASSSEDDHLSKKTN
Download sequence
Identical sequences Q6YU77
LOC_Os02g01270.1|PACid:21919802 39947.LOC_Os02g01270.1 XP_015624831.1.37577 LOC_Os02g01270.1|13102.m00042|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]