SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g40500.1|PACid:21920399 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g40500.1|PACid:21920399
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-34
Family Thioltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g40500.1|PACid:21920399
Sequence length 133
Sequence
MGMAQSSSSSSRPSDSEQLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLA
ELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVP
LLTEAGAIATPSL
Download sequence
Identical sequences A0A0E0IKH4 A0A0E0NHU5 I1P291 Q6K953
ONIVA09G12430.1 39946.BGIOSIBCE007836 39947.LOC_Os02g40500.1 LOC_Os02g40500.1|13102.m04514|protein XP_015626005.1.37577 OsIBCD007238 ORGLA02G0209700.1 LOC_Os02g40500.1|PACid:21920399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]