SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g44380.2|PACid:21920757 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g44380.2|PACid:21920757
Domain Number 1 Region: 972-1246
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-103
Family BEACH domain 0.0000000897
Further Details:      
 
Domain Number 2 Region: 1366-1450,1478-1592
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-26
Family WD40-repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 851-961
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-22
Family PreBEACH PH-like domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g44380.2|PACid:21920757
Sequence length 1664
Sequence
MEDHIYNYLAIMLEHSMRQKDGWKDVEATIHCAEWLSMVGGSSTGDQRIRREESLPIFKR
RLLGNLLEFSAQELQVQQTEGINAAAAGVAEEGMMPKETKIQADKATHLSLALAENAIVL
LMLVEDHLRSRSQHYFLSCSIDSAASPASGASSAATRSNSLSRTGSEPLDAGGSRQSLSS
DAGGLPVDVLASMADANGQISSEVMERVTAAAAAEPYGSVRHAFVSYGTCISDLSEGWKY
RSRLWYGVCIPPKSNIFGGGGSGWESWKSVLEKDSNGSWIELPLVKKSIAMLQALLLDSQ
LGGGLGIGGGSGAGMDAMSALNQLLDSDQPFFCILRLTLASIREDDNGEDDIFMRNISMK
NVISEGLGCQTGSMMIHDDNSCSPSRKPQSALLWRVLGPILNMPVSESKRQRVLVASSII
YSEVWHAVSSDRKPLRKKYVGLIMPPFVAVLKRYRSVLAGIHELTSSDGQNPLVVDDCAL
AADTLPIEAAVSMISPGWAAAFASPPVAMALAMIAAGTSGTETIAPPTNKLRRRDTSLLE
RRSAKLHTFSSFQKPIDATPNLPTSAPKDKAAAKAAALAAARDLERSAKIGSRRGLSAVA
MATSGQRRAAGDIERAQRWNTSEAMCAAWLECLQSADSKSVSGRDFSALSYKYVALLVSS
FALARNLQRVEELLTCEYTIEATFGHADGEANTVNKRKKNILAVNTMHAFFSYRHLDLLY
YFSTQIFWKLDSTETSSRMRRFMKRNYKWSEHLSMANNYEENMLLCDGAESNYSHREDAD
SLFANALRTNSSIIVADAISVDGGHGNAKQTETETIYSSVDDSTSSDFSSVHNLVRSTVV
APCYSSSKNNERIIVELPSLMVRPFKVVRGTFQVTSKMINFIIDEHMSDSDSYMDDAAST
SGQYDQQDKDRSWFISSLHKIYSRRYLLRRSALELFMVDRSNFFFDFEDTEACKHAYRAI
VHTKPPYLNSIFLATQRPEKILKKSQLTERWARWELFMQYPVFPWVLADYHSKTLDLEDP
SAYRDLSEPIGALNPARLKKFQEHYSSFNDPTIPKFHYSSHYSCPGTVLYYLVRIEPFTA
LSIQQQGGRFGQDDHMFSCINKTWNSVLEDMNDVKELVPEMFYLPELFTNVNSVDLGSTQ
LTGKLSSVQLPPWAENPVDFICKHRKALESDYVSAHLHEWIDLIFGHKQRGKDAVMANNV
FPYATYEGMVDIDQITNPVQRRSMQDQICNFGQTPSQLLTIPHTKRRPLADILKLQTIFW
NPTEVRSYVLPNPENCNVPASAMLVSDDSIVVVGANVPAAHLALHHWQPNTSNGPGTPFL
FHHGRNAINLSGGAIMRIFKGSAGSVDDYQFPRAIAFAASAIQNSSVVVVTCEREVITGG
HADNSVKLISPDGARTIETAFGHLAPVTCVALSPDSNYLVTGSRDTTVILWRIRQIGSLR
KKSTPEPPPSTPTTPNDSASGDSSTSNSSKVLETSRRRRIEGPMHVLRGHLGEVTCCSVS
SALGLVASSSSTSGVLLHNLRTGRLIRKLDKQEAHLMCLSSEGIILIWNESEKRLSTFTV
NGIPIGTSVLTPFSGRVSCIEISVDGKFALIGTCLSNSCNRDGFSAIDDYELDKPNGDDD
LPELNETKPSVHVPSVCFIDLYKLELSSKIGDRMLQEGNGVLES
Download sequence
Identical sequences LOC_Os02g44380.2|PACid:21920757 39947.LOC_Os02g44380.2 LOC_Os02g44380.2|13102.m04955|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]