SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g46240.1|PACid:21921130 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g46240.1|PACid:21921130
Domain Number 1 Region: 482-859
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-149
Family Reverse transcriptase 0.0000213
Further Details:      
 
Domain Number 2 Region: 1008-1165
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-43
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 333-439
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000152
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 
Domain Number 4 Region: 247-284
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000209
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g46240.1|PACid:21921130
Sequence length 1350
Sequence
MSNNRSKLTDFLRSRPPEFSQTVEPVEADDWLKDVDRKLNLVQCTPVEKTLYASHQLRGP
AADWWENYCNAHPEPTNIAWDEFATAFRVAHVPESTIDMKKEEFNRLKQGNSSVNEYLSM
FNKLARYAPEEVDTDKKKIRKFLKGIAVGMRLQLLAHDFPTFQHMINMALLLEDARKEAT
EEYKKRKSNHQGNSSRGAPRPRYGQPMQYHQSVTQANRQPGYAPRPQMNRPAPQPQQRAP
SGNTAPNSVTSFKSPQGPSAVQCFRCNQMGHYARQCPQNPTNTNSGHANGSTARTPTPAA
AQPRPSSQASGQGSRASNNFGRGRVNHIQAETAQDAPDVVMGMFSVNSVPAIVLFDSGAF
HSFISQAFVKRNGWKTQNLRVPMIVHSPGRNIRATQICPEVNLRIEEVDFLAKPIVLDSQ
SLDIILGMDWLAKHKGQIDCAEKSITLQGPGGKQVRFTSNTPTASRSILTCLQVTSLESV
PIVYEYPDVFPEELTSMPPDREIEFTIELAPGTAPIAKRPYRMAANELAEVKRQIEELES
KSYVRPSSSPWGALVLLVKKKDGSERMVIDYRALNEVTIKNKYPLPQIDDLFDQLKGARV
FSKIDLRSGYHQLKIRSEDIPKTAFSTRYGLYEFTVMSFGLTNAPAFFMNLMNKIFMEYL
DQFVVVFIDDILIYSKNKEEHAEHLRLIMEKLRDHQLFAKFSKCEFWLDRVAFLGHVISS
NGVEVDPSKVEAVLAWNPPKNVSEIRSFLDLAGYYRRFIEGFSKLARPMTELLKKENKFQ
WSAACEDSFQKMKKRLTTAPVLTLLDIRKDFEIFCDASRQGLGCVLMQERKVVAYASRQL
RPHEVNYPTHDLELAAVDYDLGIHDHPGKANVVGDALSRKAYSNVAQIRPDQDRLCRELE
KLRLTVVQSGVPASLTVQPTLESQIREAQKDDEGIKELIKRIQEKKDTDFSIDDQGTVWC
GPRICVPAKKELRDLILKEAHESAYSIHPGSTKIVKAEHQRPAGLLQPLPIPEWKWEEIG
MDFITGLPRTPSGYDSIWVIVDRLTKSAHFVPVKTTFDGKKLAELYMTHVVCRFGCPKKI
VSDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACALDFEGTW
DCCLPYAEFSYNNSYQASIQMSPNEAMFGRKCRTPLCWNEVGEALVFGPDILKAAEEQVK
LIRERLKTAQNRQKNYADNRRRDLEFEKGDHVYLRVSPLRGMRRFGMSGKLAPRYIGPYL
ITARRGEVAYQLELPEGLVDVHNVFHVSQLKKCLRVPEEQVPLGNIVLEKNLTYKERPIK
VLEEAERQTRRKTIKFYKVQWSNHSEDEAT
Download sequence
Identical sequences LOC_Os02g46240.1|PACid:21921130 39947.LOC_Os02g46240.1 LOC_Os02g46240.1|13102.m05187|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]