SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g50550.1|PACid:21921884 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g50550.1|PACid:21921884
Domain Number 1 Region: 47-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-32
Family G proteins 0.00068
Further Details:      
 
Domain Number 2 Region: 583-704
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-18
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g50550.1|PACid:21921884
Sequence length 923
Sequence
MSSSAMEAMDELVQLAESMRQAASLLADDDPSDEASPRRPSTFLNAVALGNVGAGKSAVL
NSLIGHPVLPTGENGATRAPIVVDLQRDPGLSSKSIVLQIDSKSQQVSASALRHSLQDRL
SKGASGGSGKGRNDEIYLKLRTSTAPPIKLVDLPGIDQRVMDDSTISEYAGHNDAILIVV
IPAMQAADVASSRALRLAKDIDPDGTRTIGVLSKIDQASADAKTVSCVQAILSNKGAPRA
AAEIEWVALIGQSVSIASAQAGSVGSENSLETAWQAEAETLKSILTGAPRSKLGRIALVD
TIAKQIRKRMKIRLPNLLSGLQGKSQIVQNELARLGEQMVSSAEGTRAVALELCREFEDK
FLAHVTSGEGSGWKIVASFEGKFPDRIKQLPLDRHFDINNVKRIVLEADGYQPYLISPEK
GLKSLIKGVLEMAKEPSRLCVEEVHRVLLDIVNASANATPGLGRYPPFKREVVEIATNAL
DVFKSDAKKMVVALVDMERAFVPPQHFIRLVQRRMERQRREDEVKNRSSKKAQDAEQSNK
GSGTGSEQSGGALKSLKEKFSQQDKDKDAKEGPNLQVAGPGGEITAGYLLKKSAKNNEWS
KRWFVLNEKSGKLGYTKKQEERHFRGVIVLEECNLEEIEEEELSKSLKDSKKANGAEKGP
SLVFKITNRVAYKTVLKSHSAVILKAETIADKVEWMKKIRGVIQSKGGSVKGLNTPEGGS
MRQSHSDGSLDTMARKPADPEEELRWMSQEVRGYVEAVLNSLAANVPKAIVLCQVEKAKE
DMLNQLYSKISAQTNAKIEELLQEDHNAKRRREKYQKQSSLLSKLTRQLSIHDNRASVAS
YTNDSSGAESSPRTSGQSGEDWRSAFDSASNGSVDRSSSHNETRSRSADSRGKRYENGDV
NGGNSGSRRTPNRLPPAPPGQKY
Download sequence
Identical sequences I1P432 Q0DXR0
ORGLA02G0273800.1 LOC_Os02g50550.1|PACid:21921884 LOC_Os02g50550.1|13102.m05736|protein XP_015626661.1.37577 39947.LOC_Os02g50550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]