SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g07470.1|PACid:21914960 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g07470.1|PACid:21914960
Domain Number 1 Region: 144-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000103
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g07470.1|PACid:21914960
Sequence length 322
Sequence
MGCTTSRQARHDLRHCPSPLALPRCQSFPARCAGDAGVHVVRLTSTTLGSLEVDKGAPRA
AEAPPMRRMVPRTPTMTPPNEPEAIDAWALMAGLEEHSPLLVPPFARHSFSFPITAVPPE
LAAASRKVTPLPLVEKKKASPVARPRKAVLYFTSLRGVRATHEDCCLARAILGGYGVRVD
ERDVSMHRGFRDELHGLLGLGRGAALAKCWAPAAAPALPSLFVDGELVGNADELKRLHEA
GELAARLAGCESAAPGEAAGACEACADVRFVLCGACSGSCKVYVDDGDDDDENPLDGGGG
GGFRRCTECNENGIVRCPVCCC
Download sequence
Identical sequences A0A0E0GHG1 A0A0E0NQB9 A2XD09 Q8S7X1
LOC_Os03g07470.1|PACid:21914960 ONIVA03G05130.1 LOC_Os03g07470.1|13103.m00835|protein XP_015630259.1.37577 OsIBCD038523 39946.BGIOSIBCE009834 39947.LOC_Os03g07470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]