SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g17070.1|PACid:21915204 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os03g17070.1|PACid:21915204
Domain Number - Region: 70-183
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.022
Family BAR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g17070.1|PACid:21915204
Sequence length 211
Sequence
MATAMMAATATSCSPRRAPVVASSSVQPPRRQQQQQPRRGLKQLPGLVATAAVAVAAAPL
PALAEQMEKAALFDFNLTLPLIATEFLLLMVALDKLYFTPLGKFMDERDAKIRAELGGVK
DASEEVRQLEEQAAAVLKAARAEIAAALNKMKKETTQELEAKLDEGRRRVEAELVEALAN
LEAQKEEAVKALDAQIASLSDEIVKKVLPSA
Download sequence
Identical sequences Q84PA4
39947.LOC_Os03g17070.1 XP_015630476.1.37577 LOC_Os03g17070.1|13103.m02041|protein LOC_Os03g17070.1|PACid:21915204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]