SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g23200.1|PACid:21911324 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g23200.1|PACid:21911324
Domain Number 1 Region: 817-1220
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-169
Family Reverse transcriptase 0.0000135
Further Details:      
 
Domain Number 2 Region: 1395-1554
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.88e-43
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 3 Region: 675-764
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000736
Family Retroviral protease (retropepsin) 0.061
Further Details:      
 
Domain Number 4 Region: 614-655
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000075
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g23200.1|PACid:21911324
Sequence length 1724
Sequence
MSWQRVGALLLGAQSCLPVPGVPAVGGIGSVLLSMARMGWKLCHVFRLYTVVMAGHPPNH
RGEGMIDFVAELARMTLVVGYPNAPEYTTIPPLSGELPHRVRLEVHGYVGTCLANMAVEA
SGGTADHACQEAAYLMMARLRERHNYIFHDTAYRFHPRRAHGDDVSSFRPTAGENDTTFG
HMCTVMRGLDRMHSDLHKATKALNDGKLMRIVALKDEIARLKKENAQLKGLPAPGGVRIR
TTPRKRTTAPVRIQLAPRNPVPPAAPAAPPVPPAAPAVPAAPAPAPAFALSFALASAARG
PASGTGGCLFGMVYTRTGNRTTGEGSNGEERVDGVHPNSDSGNGPPPLPENPTLAQVMAH
QTQMMAAMMQQMQQQHQQMHQRMMQHAEQQHQQFGPPPPQSKLPEFLREKVAFATHQLQG
PASAWWDNHMATRPPGTEVTWAEFCRSFRKAQVPDGVVAQKKREFRALHQGNRTVTEYLH
EFNRLARYAPEDVRTDAEKQEKFMAGLDDELTNQLISGDYADFERLVDKAIRQEDQRNKM
DRKRKAAQFRAPQGSHQRPRFTPGQQGGPTTMIVRQHRPFNSSNFHQGSSGSQNHHGGQP
NRGAAPRPPMAPAQSGPPAQAKKETGAKPGSCFNCGELGHFADKCPKPRRAGPRFIQARV
NHASAEEAQTAPEVVLVLFDSGATHSFISKKFVGRYGLRKEELSTPMRVHTPRNSSTSVS
FSPSVLIEIQRSPFLANLILLESKDLDVILGMDWLTKFKGVIDCANRTVTLTNEKGETVV
YKSPDSPKQGVSLNQIEAEIPVDTVEKNLRKLEDIPIVCEYPEVFPEDLTTMPPKREIEF
RIDLAPGTAPIYKRPYRMAANELAEVKKQVDEQLQKGYIRPSTSPWGAPVIFVEKKDKTK
RMCVDYRALNEVTIKNKYPLPRIDDLFDQLKGARVFSKIDLRSGYHQLRIREEDIPKTAF
TTRYGLYECTVMSFGLTNAPAFFMNLMNKVFMEFLDKFIVVFIDDILIYSKSEEEHEQHL
RLVLEKLKEHQLYAKFSKCDFWLTEVKFLGHVITAQGVAVDPSNVESVTKWTPPKTVSQI
RSFLGLAGYYRRFIENFSRIARPMTQLLKKDEKFKWTAECDKSFEELKKKLVSAPVLILP
DPTKDFQVYCDASRHGLGCVLMQEGRVVAYASRQLRPHEGNYPTHDLELAAVVHALKIWR
HYLIGNRCEVYTDHKNYDMSIHYHPGKANVVADALSRKSYCTALCTEGMCEELRQEFEHL
NVGIVEHGFVAALEARPTLVDQVRAAQVNDSEIVELKKNMRVGKARDFHEDEHGTIRMGE
RLCVPDDKELKDLILTEAHQTQYSIHPGSTKMYQDLKEKFWWVSMRREIAEFVALCDVCQ
RVKAEHQRPAGLLQPLQIPEWKWEEIGMDFITGLPRTSSGHDSIWVVVDRLTKVAHFIPV
HTTYTGKRLAELYLARIMCLHGVPKKIVSNRGSQFTSKFWQILQEELGTRLNFSTAYHPQ
TDGQTERVNQILEDMLRACALDFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGRKCR
TPLFWDQTGERQLFGIEVLAEAEQKVRIIRERLRIAQSRQKSYADNRRRELTFEAGDYVY
LRVTPLRGVHRFQTKGKLAPRFVGPYKILERRGEVAYQLELPSNMIGIHDVFHVSQLKKC
LRVPEEQADSEHIDIQEDLTYVEKPVRILDTSERRTRNKVTRFC
Download sequence
Identical sequences Q10LC5
39947.LOC_Os03g23200.1 LOC_Os03g23200.1|PACid:21911324 LOC_Os03g23200.1|13103.m02802|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]