SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g25970.2|PACid:21912266 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g25970.2|PACid:21912266
Domain Number 1 Region: 133-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.11e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 358-439
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 32-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000958
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 4 Region: 269-330
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000127
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g25970.2|PACid:21912266
Sequence length 542
Sequence
MVGPGHRNSHGKRHSDYAENGGGKRRNPGDDTYAPGPDDTVYRYLCPSRKIGSIIGRGGE
IAKQMRADTQAKIRIGESVSGCDERVITIFSSSRETNTLVDAEDKVCPAQDALFRVHEKL
SIDDDIGNEESDEGLAQVTVRLLVPSDQIGCIIGKGGHIIQGIRSDTGAHIRVLSNENLP
ACAISGDELLQISGDSTVVRKALLQVSSRLHDNPSRSQHLLASSMTQPYPVGSHLGSSST
APVVGITPLISSYGGYKGDVAGDWPSIYQPRREESSAKEFSLRLLCAASNVGGVIGKGGG
IIKQIRQESGAFIKVDSSNTEDDCIITVSAKEFFEDPVSPTINAAVHLQPRCSEKTDPES
AIPSYTTRLLVSTSRIGCLIGKGGSIITEIRRTSRANIRILSKENVPKVAAEDEEMVQIS
GDLDVVRHALLQITTRLKANFFEREGALSGFPPVIPYHPLPVGVSEGPKYLGRDTKPLGH
DYPYSSGYRGSDDIGPIDSYASYGSSQVSGGGYGAYGGYSGRSGSSGLSGPSSFSYGKRH
GY
Download sequence
Identical sequences Q10KN9
39947.LOC_Os03g25970.1 LOC_Os03g25970.1|13103.m03054|protein LOC_Os03g25970.2|13103.m03055|protein LOC_Os03g25970.1|PACid:21912265 LOC_Os03g25970.2|PACid:21912266 XP_015632182.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]