SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g43510.1|PACid:21910990 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os03g43510.1|PACid:21910990
Domain Number - Region: 354-460
Classification Level Classification E-value
Superfamily PH domain-like 0.000521
Family Pleckstrin-homology domain (PH domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g43510.1|PACid:21910990
Sequence length 474
Sequence
MGDHHHHHHPRRGSRHAAAGDLRPPEPPLDPLEFLSRSWSASASALDAPRPPPPAPSPSA
VLGIGPIAEDASSAATAACEVVDDGSAFAAAGSSFSFASAATSQLIMERILAQSEVAPLT
SGRLSHSSGPLTGGGSITDSPPVSPEIDDAKYCRAASTPKPQMYRGGNKTVGRWLKDRKE
KKKEETRAHNAQVHAAVSVAAVAAAVAAVAAATAAASGSGKDDRAARTDMAMASAATLVA
AQCVEAAESMGAEREHLEAVIGSAVNVRTPGDIVTVTAAAATALRGAATLKARALKEVWN
IAAVIPVEKGTMGGGHHHKQNMQKQHRKLESNGSSISDDLSLEEENNFLGICSQELLARG
TELLKRTRKGALHWKVVSVYINRMGLVMLKMKSRHVAGTITKKKKSVVIDVCKDVAAWPG
RHLLEDGEHRRYFGLRTAEHRVIEFECTSQREYEMWTKGVARLLIIASERKRAP
Download sequence
Identical sequences A0A0E0NYK7 Q75GL2
39947.LOC_Os03g43510.1 LOC_Os03g43510.1|13103.m04677|protein LOC_Os03g43510.1|PACid:21910990 XP_015628934.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]