SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g44360.1|PACid:21911802 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g44360.1|PACid:21911802
Domain Number 1 Region: 461-808
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.34e-130
Family Reverse transcriptase 0.0000849
Further Details:      
 
Domain Number 2 Region: 981-1127
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.88e-21
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 314-417
Classification Level Classification E-value
Superfamily Acid proteases 1.5e-16
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Domain Number 4 Region: 228-262
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000152
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g44360.1|PACid:21911802
Sequence length 1299
Sequence
MASRRRASTSNEETQTPDLTTLAGVMATQTQLLQAIANNQGNRGGSSFEEFMRTKPPTFA
TADEPMEAEDWLRIIEKKLTLVRVREADKVIFAVHQLEGPAGDWWDTYKEAWEEDAGEPT
WEEFTTVFRENFVPAAVMRMKKNEFRRLRQGNATVQEYLNQFTQLARYAIGDLADEEEKI
DKFIEGLNDELRGPMIGQDHESFQSLINKVVRLENDQRTAGCDSEPHPYTNSGCPCSQEN
VDCFNCGEYGHYANNCPHPRKTPVRTGANAMTVRGTTTPTTGRGLFKTPQTNRTATGFGR
GQVNHVRAEEAQEDQGILMGMFSINSTPVKVLFDSGASHSFISLKASQKHNLALVGLRKP
MIVHSPRGEITVSHACIDVPIRLRNVVFPSNLMVLIPKTLDVILGMNWLTKNRGVIDCRR
REVILTTPWGSDMRTTMDQDPRLAERAGGIFTMLPMKGMPVVQRFPDVFPEDLLGMPPDR
DIEFIIDLIPRTAPISKRPYRMPKVTIKNKYPLPRIDDLFDQLKGAKVFSKIDLRSGYHQ
LKIRTGDIPKTAFSTRYGLYEFTVMSFGLTNTPAYFMNLMKKVFMDYLDKFVVVFIDDIL
IYSKDEEEHAKHLRLVLEKLRKHKLYAKFSKCEFWLKEVAFLGHVISAGGVAVDPAKVEA
VTKCKAPKSMTEIRSFLGLAGYYRRFIEGFSRIARPMTQLLKKEKKFAWSEQCQESFEQL
KEKLTSAPILVLPDIRKNFVIYCDASRQGLGGVLMQDGKIWRHYLIGNHCDIYTDHKSLK
YIFTQSDLNLRQRRWLELIKDYDLEVHYHPGKGNVVADALSWKSHCNHLKTEGMAPELKE
EMAQLNLHIVPRGQINTLDIQPLLRTQIEEAQKDNEEIREVKEHLAAGFAKEFSTDEKDV
LWYKKRIYVPEQGGLRGLILKEAHKSAYSLHPGSTKMYQDLKEGYWWPNMKRDVAEYVAL
CDVCQKVKAEHQRPAGLLQPLRIPEWKWDEIGMDFIVGLPKTATGYDSIWVIVDRLTKTA
RFIPVKTNYSSAKLAELYMTRIYVFMVYLRELYLIEAHSLPRISGRNTAYHPQTDGQTEG
TNQVLEDMLRACALDFSKDWERCLPYAEFSYNNSFQASLKMSPNEALFGRRCRTPLMWSE
TGERAVFGPDIIKEAEEKVRLIQDRLKVAQSRQKSYADTRRRNLEFKEGDYVYLKVSPMR
GTKRFKVKGKLAPRYVGPFQITARRGEVAYQLQLPENIADVHPVFHVSQLKKCLRVPEEQ
APLEEIHISNDLTYPEHPVRILDEAEKRTRTKVWRMYKV
Download sequence
Identical sequences Q10G32
LOC_Os03g44360.1|PACid:21911802 39947.LOC_Os03g44360.1 LOC_Os03g44360.1|13103.m04774|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]