SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g45550.1|PACid:21913046 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g45550.1|PACid:21913046
Domain Number 1 Region: 645-1074
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.34e-173
Family Reverse transcriptase 0.0000178
Further Details:      
 
Domain Number 2 Region: 1246-1405
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.92e-42
Family Retroviral integrase, catalytic domain 0.0094
Further Details:      
 
Domain Number 3 Region: 501-606
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000173
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 4 Region: 438-473
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000209
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g45550.1|PACid:21913046
Sequence length 1564
Sequence
MFEAGGGNYIHACQEVARIAIGELRDRYSDQLADTEYRYHPRQPQGSDRGSYLETERIEN
DATTRHLVEMLWAMDETRAETVLAAQDREDRNRGKICKLEDKVDRLEKELAALKGEAPPQ
KARIRLTARKRALFVPRYQMAPKVRVAEKEVTLALADPPVVNMVLTRSNGNSPNINNNNN
NNGENPTLAQVLAQQAQLMNMMMQQLQNQQNQGNNHAPPQNKLAEFLRVRPPTFSSTTSP
VEPGDWLHAIEKKLDLLQCTDQEKVSFASHQLHGPASEWWDHFRLNRTTVEPITWLEFTA
AFRKMHIPSGVLSLKKKEFRSLTQGSRSVTEYLHEFNRLARYAPEDVRTDKQRQERFLEG
LNDELSYPLMTGDYHDFQKLVDKAIRQEDNQRPHLTLGPQSLPQGGSSSVVRPQRQFFNN
NAGNNIRNQAPRPVAAPTQQQPAKREQGSKPGVCFNCGDPGHYSDKCPKPRRVKVVPAQS
NSTAPALKARVNHVAAAEAQGAPDVILGTFLVNSVPATVLFDSGATHSFLSMSFVGNHGM
EVEDLRRPLMVSTPSNQALSLQRSPSVRIEIQEVTFLANLILLESKDLDVILGMDWLARY
KGVIDCANRKVTLTSNDGQVVIVHALSSESLRSSLNQMTLEEIPIVREYPDVFPDDLPGM
PPKRDIEFRIDLVLGTIPIHKRPYRMAANELAEVKRQVDDLLQKGYIRPSSSPWGAPVIF
VEKKDHTQRMCVDYRALNDVTIKNKYPLPRIDDLFDQLKGATVFSKIDLRSGYHQLRIKE
EDIPKTAFTTRYGLFECTVISFGLTNAPAFFMNLMNKVFMEYLDKCVVVFIDDILIYSRT
KEEHEEHLRLALKKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWK
QPKTVSEIRSFLGLAGYYRRFIENFSKIAKPMTRLLQKDVKYKWSEEYEQSFQELKNRLI
LAPILILPDPKKSFQVYCDASKIGLGCVLMQDGKVVAYASRQLRPHEKNYPTHDLELTAV
VHALKIWRHYLFGTRTEVYTDHKSLKYIFTQPDLNMRQRRWLELIKDYDMGIHYHPGKAN
VVADALSRKGYCNATEGRLPLELCKEFERLNLGIVSRGFVAALEAKPTLIDQVREAQIND
PDIQEIKKNMRRGKAIGFLEDEQGTVWLGERICVPDNKDLKDAILREAHDTLYSIHPGST
KMYQDLKERFWWASMKREIAEYVAVCDVCQRVKAEHQKPAGLLQPLKIPEWKWEEIGMDF
ITGLPRTSSGHDPIWVIVDRLTKVAHFIPVKTTYSGRRLAELYMARIVCLHGVPKKIVSD
RGSQFTSKFWKKLQVEMGSKLNFSTAYHLQTDGQTERVNKILEDMLRACALDFGGSWDKN
LPYAEFSYNNSYQASLQMAPYEALYGRKCRTPLLWDQTGERQVFGMDILREAEEKVKIIQ
ERLRVAQSRHKSYADNRRRDLSFEEGDHVYLRVTPLRGVHRFHTKGKLAPRFVGPYKIVS
RRGEVAYQLELPQSLAGVHNVFHVSQLKKCLRMREEPGIELSIFAKSNGVITRKKNQLGN
EKTN
Download sequence
Identical sequences Q7Y0A9
LOC_Os03g45550.1|PACid:21913046 39947.LOC_Os03g45550.1 LOC_Os03g45550.1|13103.m04903|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]