SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g46340.1|PACid:21914493 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g46340.1|PACid:21914493
Domain Number 1 Region: 30-130
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-16
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g46340.1|PACid:21914493
Domain Number - Region: 261-305
Classification Level Classification E-value
Superfamily BAS1536-like 0.0471
Family BAS1536-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g46340.1|PACid:21914493
Sequence length 500
Sequence
MATNGSSPRARETESSLEKVKRQLSSGSGRYLLQGPLLKRSETLRKWNERWVILDPTSGK
MEYKIRRNETAIKGTIIFDASSTITLSPVNFQGMPKYDGCCFYIGTPQKKDYFLCAETPG
AAKAWVSTLLATQLVLQAHKEAVNSLAGNGSPATLGTVATAVANANATALEATKEIEAAM
KVSMRAALGLGANNPKEGQLDDLTIMKETLRVKDEELQNLAKDIRARDATIKEIANKLTE
TAEAAEAAASAAHTMDEQRRLLCSEIERLRQAMERQMEQSMLKLRQSEEKVISLSKEKDQ
LLKERDAALQEAHMWRTELGKAREQAVIQEATIARADEKVRASEADAAARIKEAAEKLHA
VEKEKEELLSLVGILQSQVQREQSSTKQVCEERSESCSGTDNSPPLTKHVDASDDDVDKA
CVSDSRSVLVSNDNTEVQLAVDGVDIRPIGDAEWGSFQQSEALIADVREVSPESEGGSLD
IPVVNPPPVSDHIQGGATHP
Download sequence
Identical sequences B8ANN2 Q75H96
LOC_Os03g46340.1|PACid:21914493 39947.LOC_Os03g46340.1 XP_015630802.1.37577 LOC_Os03g46340.1|13103.m04986|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]