SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g46480.1|PACid:21916299 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g46480.1|PACid:21916299
Domain Number 1 Region: 230-373
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-17
Family Ran-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g46480.1|PACid:21916299
Sequence length 377
Sequence
MDRPSFGVHRAESSHQHMMAGPATLDPQRAEAANKHVRALNSQFASWVQSQLQNHPAELW
EDGMRDYISHASEIMEKFKDVVNWIRQNKTGSAVVLSPGPPNDEKTISPAAVDSKFTVQS
SPDNGQKGPVTAASSPAFQNSSSPNLFSFASHQKTPAFTGIFGDKKNMPGDSNKPSFQFG
ANNGFSTPSMPSIFSASGAQSFSMPSQTLFSVNQQPAISGNKSAAEASGDADEDAEPEQP
SSPSVKKAEEKGIVVVYEAKCKVYVKHDDPANGWKDIGVGQLNIRCKEGAEKASKESTPT
IVIRNDVGKILLNALIYKGIKMNVKKSTVASIFHTSDGQPSESGSATVVARTYLIRVKND
EAAAKLSAAIMENAPLE
Download sequence
Identical sequences Q10FH5
39947.LOC_Os03g46480.1 XP_015628125.1.37577 XP_015628126.1.37577 LOC_Os03g46480.1|PACid:21916299 LOC_Os03g46480.1|13103.m05004|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]