SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g47896.1|PACid:21912933 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g47896.1|PACid:21912933
Domain Number 1 Region: 36-275
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 6.03e-51
Family Shiga toxin, A-chain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g47896.1|PACid:21912933
Sequence length 291
Sequence
MALFLPLLVAASLFSPAAALLAGGEHGVVVVEPRQVEIMFDLATQSWYHELYRPLKAALT
DDGAGPELMGHAVVDLLDDDQPPSKQITVRLFASGGGGDEAKLLVAEDDAYVAGFANRTG
HWHTFRGGRCHHPVIIPAGGAAPCTELPFGGTYRELIGGVANLRAVPLGRASAESAMRVL
SRYDPATTPAADAKMVVAKFMVMVTEPMRLKAVSRAVGGRWEEESYLSSDEAKYVPYWGE
ISAMLVEWNSTGRWGELGPRSKMDRARCPRPAGCEDDGGDGDDGGGKLFMI
Download sequence
Identical sequences Q10F32
LOC_Os03g47896.1|13103.m05165|protein 39947.LOC_Os03g47896.1 LOC_Os03g47896.1|PACid:21912933 XP_015630235.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]