SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g53280.1|PACid:21917421 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g53280.1|PACid:21917421
Domain Number 1 Region: 2960-3248
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-123
Family BEACH domain 0.0000000227
Further Details:      
 
Domain Number 2 Region: 3280-3501,3533-3577
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.17e-29
Family WD40-repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 2768-2811,2871-2934
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-16
Family PreBEACH PH-like domain 0.037
Further Details:      
 
Domain Number 4 Region: 1082-1274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000634
Family Laminin G-like module 0.055
Further Details:      
 
Domain Number 5 Region: 495-634,687-726,775-837,930-993
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000013
Family Regulatory subunit H of the V-type ATPase 0.064
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g53280.1|PACid:21917421
Domain Number - Region: 21-29
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 217-234,266-395,489-571
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family Regulatory subunit H of the V-type ATPase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g53280.1|PACid:21917421
Sequence length 3582
Sequence
MKWSTLLSKVVFAGQQEQEQPPPPPPPPPGSSSSPLNRQKQGDPGQATPRLSAADEGGSV
GGGGVAAASGSSPSAVSASPASSSFPDYIHVPIGNKGKNELELDFRRFWEEFRSSSSEKE
KERALNLAVDVFCRLVKEHSSVAELVTKLVEAHVFAFVIGRAFVTDVEKLRIHSKGRSLR
VADVIGFFSEITELGICPGSNLLYAVEVLVTQTIDKQPLLDSGILCCLIYILNSLLSPDE
SSQKSSPVGQEVSTSEKSKDWGPMLSRRLEIEASVVHTMKALASHPSAAPSLIEDDALQV
LFHMVANGSLTVFSQFREGLVPIHTIQLHRHAMQIKVLLMAVKDFNPQNGDAAYTMGIVD
LLLECVELSYRPEAGSVRLREDIHNAHGYQFLVQFALTLCSLHKNQVLQSSPKLASEDGV
NPPHRSEQDTFTSDLSPQLSRLLDVLVNLSQTGLSENYVGKSMKSSHGKGTGHNRSRTPS
VDKFADEILEINSPKVKDLEAIQMLQDIFLKADNLEVQAEVLNRMFKIFSSHLENYKLCQ
QLRTVPLFILNMGGFPPALQEVILKILEYAVTVVNCIPEQELLSLCCLLQQPISTSLKHT
ILSFFVKLLSFDQQYKKVLREVGVLGALLDDLKQNKLFFGEEPQNRTPKSAQRMSSASSF
RKTMDNKDAILSPKLMASGSTKFPMFEDEGTITVAWDCLFYLLKRAEPNQQTFRSSNGVN
TILPFLVSESHRSGVLRLLSCLIIEDSLQAHPEEIGSLIEILKSGMVSTSSGSQQKLDND
AKCDTFGALWRILGANSSAQRIFGEATGFSLLLTTLHSFQNDSENEETESSLLTHMKIFG
FLMRAMTAAVYSNPVNRIRLHTILSSNTFYDLLSESGLLCVDCEKHVILLLLELALEVVL
PPTSNLQVESISSENPEDESGFLSATSFGLSRLDKERIYNASAVVVLIRSLLVFTPKVQL
ELLRFIEKLANAGPFNQENLTSVGCVGLLLETINPFLEGSSPILNHALRIVEVLGAYRLS
SSELRLLVRYILQLKVKCSGHLFVNMMDKLIQIEDVRQGSISLAPFIELDMSKAGHSSIQ
VSLGERTWPPVSGYSFVCWFQFQNFFRSHPKEAEKTSKGSYSKRNGQVMRIFSVGAVDDA
NTLYAELYLHDNGVFTIATSNSSSLSFPGIEMEEGKWHHLAVVHSKPNALAGLFQSSVAS
LYLDGKLRHTGKLGYSPSPFGKSLQVTLGTPAIRAKVSDLSWRLRCCYLFEEVLTPGSIC
FMYILGQGYRGLFQDTDLLRFVPNWACGGEVMAILDSLELEVIAPSGSQRVDSAMKQGNS
RLESSGIVWDMERLRNLSLQLSGKKLIFAFDGTSSDAFRASGTLSLLNLVDPTSAAASPI
GGIPRYGRLSGDVYVCNQCTIGDTVQTVGGIPVVLALVEAAETRDMLHMALELLALSLQQ
SHQNVKDMQSLRGYHLLALFLHRRMSLFDMQSLDIFFRIAACGASFPEPQKSNMNRTASY
ASGISPESSLDDLTLPKFGDDMSSIGSHGDLDDFSAQKDSFSHLSELENADLAGETSEFI
VLSNADMVEHVLLDWTIWVTAPISVQITLLGFLERMVSMHWFRNHNLTILRRINLVQHLL
VTLQRGDVEIPVLEKLVVLLGVILEDGFLASELELVVRFVIMTFDPPELTPNRQIVREAM
GKHVIVRNMLLEMLIDLQVTINAEDMLEQWHKVVSSRLVTYFLDEAVHPTSMRWIMTLLG
VCLTSSATFALKFRTSGGFQGLNHVLPSFYDSPEIYYILFCLIFGKPVFPRVPEVRMLDF
HSLMPSDENCGELKFVDLLDTIIAMAKATFDSLIMKSMLAHQNNNLSHLNGTLVADLVES
TPDMGGDLQGEALMHKTYAARLMGGEAAAPAVATSILRFMVDLTKMCPPFSAVCRRHDFL
ESCVDLYFSCVRSDCAVKMAKDLTSAATDEKCMHDDDNESLKDTFSNLPQDQEQSAKTFS
IASFPQEQKSSSSGSSGMHNSFETAEVKADDSSNQASSTTFLNGQANQVVQSAHDQGQMS
APSSNGIADSHQPADSPTSASMNNIGSPVLSERSAHKAASTPTASPMAPFASWPGSAGSY
SDGRQLTASPSMSSTISGIDLDSSPDLKTNIQGSPAVNTLFPINSKLLLDIDDLGYGGGP
CSAGATAVLDFIAQILADIISEQLKATLFIESILECVPLFVDIDSALVFQGLCLSRLMNF
LERKLLLDDEEDGKKLDKSRWSANLDPLCWMIVDRVYMGCFPTPVGVLRTLEFLMSMLQL
SNKDGRIEDAVPSGKGILSIARGGRQLDPYIHAILKNTNRMVMYCFLPTFLKNMGEDDLL
ANLAFLTETGRSLGIFKPSQEDYTVDICTVLQLLIANKRLVLCPSNVDNDLMCCFCINLM
ALLRDKRLTAQNLAVDLLKYLVVHRRPSLEDLLVSKPNQGQQMDILHGGLDKLLTGSTTA
FFEWLQSSQQTISKVLDQCALIMWVQYITGSAKFPGVRIKGMEVRRKKDMGRKLREIAKL
DSRHWEQINERRYNLDLVRDVMSTELRAIRQDKYGWILHGESEWQSQLQQLVHERGIFPV
RQLSTEPAWQLCAVEGPYRMRKKLEPSKFKIDTIHNVLASNLGLDDVKITKKEDGHMVMT
SGSDTMSGLNLLTYDTERKDLDAADFASFKDEDDIFKGGSTVSPPIGWTDDKSSINEQSL
HSATEHGAKSSSFSYHMTESVHGKSEFNSPRRAPSVKGTDTRTSEDKSEKELLDNGEYLI
RPYLEPSEKIRHKYNCERVAGLDKHDGIFLIGELSLYIIENFYIDDSNCIYEKGNEDELS
VIDQALGVKKDVLGSCDSHQKSPSTWGATAKVLLGGRAWAYNGGAWGKEKLCSSSNLPHP
WHMWKLDSVHELLKRDYQLRPVAIEIFSMDGCNELLVFHKKEREDVFKNLTAMNLPRNSM
LDTTISASSKQDSGEGSRLFKIMAKSFSKRWQSGEITNFQYLMHLNTLAGRGYSDLTQYP
VFPWVLADYESDTLDLRNPQTFRKLDKPMGCQTEGGEEEFRKRYDSWDDPEVPKFHYGSH
YSSAGIVLFYLLRLPPFSMENQKLQGGQFDHADRLFNSVKDTWVSAAGKSNTSDVKELIP
EFYYLPEFLENQFNLDLGEKQSGEKVGDVVLPPWAKGSSREFIRKHREALESDYVSENLH
HWIDLIFGYKQRGKAAEDAVNVFYHYTYEGNVDIDSVSDPTMKASILAQINHFGQTPKQL
FQKPHPQRRTDRKVLPHPLRYSAYLTHQEIRKTTSSVSQIVTYNDKILIAAANSFLKPVN
YSEYISWGFPDRSLRILTYDQDKLVSTHENLHGGSQIQCTGVSHDGNILTTGGDDGVVAV
WRFFKDGTRRLLRMEKALCAHTAKITCIYVSQPYSLIVSGSDDCSVILWDLTSLAFVKQL
PRFPASVSALHVNNLTGEILTGAGVLFAVWSVNGDCLAVVNTSQLPSDLILSVASTTNSD
WQDTNWYVTGHQSGAVKVWKMVHYTSDEAANSKSKSPPSTLGGMSLNGQTQEYRLLLQKV
LKAHKHPVTALCLPPDLKQLLSGDASGHLFSWSLKDDSFKVS
Download sequence
Identical sequences Q10D20
39947.LOC_Os03g53280.1 LOC_Os03g53280.1|PACid:21917421 LOC_Os03g53280.1|13103.m05817|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]