SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g06110.1|PACid:21893604 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g06110.1|PACid:21893604
Domain Number 1 Region: 434-833
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.78e-154
Family Reverse transcriptase 0.0000723
Further Details:      
 
Domain Number 2 Region: 290-394
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000938
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 
Domain Number 3 Region: 228-263
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000178
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Domain Number 4 Region: 977-1069
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000278
Family Retroviral integrase, catalytic domain 0.049
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g06110.1|PACid:21893604
Domain Number - Region: 1181-1255
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000357
Family Chromo domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g06110.1|PACid:21893604
Sequence length 1287
Sequence
MTTTAAFPSDGNDWSDGDARLERRRQQRREGPAYLWSDHFQATQPEGQPTTWARFTAAFR
RTHVPAGVMALKKREFRELKQGNRSVMEYLHEFNNLARYAPEDVREDEEKQEKFLAGMDP
ELSVRLVSGDYPDFQRLVEKSIRLEAKHKELESHKRRLANFRNQPGANQRVHYTNPYPGG
ILLAAATAAATMLRAPTSIRGARPTAAATAESARDPCACPPAPVVQPSQGRRDIQGQQRL
CFNCFEPGHFADKCPKPRRKQGQAPPRPNNGGKDVIRGRANHVTTEDVLTTPDVIVDTFL
IHSILATILFDSGASHSFISVPFVGRNQLGVERLRNPLLITTPGGVMTAMYYSPAVPIEI
QGIPFPSDLILLDTKNLDVILGMNWLAQFQGVVDCAKCTVTLYRGPEQPVVFFAPPTSVG
SSELHQIGLSEIPIVSEFGDVFPDELPGMPPKREIEFRIDLAPGTTPLYRRPYRMAANEL
PEVKKQLEELKEKGYIRPSTSPWGAPVIFVEKKDKTKRMCVDYRALNEVTIKNKYPLPRI
DDLFDQLKGATVFSKIDLRSGYHQLRICEEDIPKTGFTTRYGLYEFTVMSFGLTNAPAFF
MNLMNKVFMEYLDKFVVVFIDDILVNSQSEEDHQQHLRLVLGMLREHQLYAKLSKCEFRL
SEVKFLGHVISAKGVAVDTETVTAVTDWKQPKTLLKKEEKFVWSPQCEKAFQTLKEKLVS
SPVLILPDTRKDFIVYCDASRQGLGCVLMQEGHVVAYASRQLWPHEGNYPTHDLELAAVV
HALKIWRHYLIGNRCEIYTDHKSLKYIFTQSDLNLRQRRWLELIKDYDVGIHYHPGKANM
VADALSRKSRCNTLGVRGIPPELHQQMEALNLSIVGRGFLATLEAKPTLVDQIHETQKND
PDMHGILKNMKQSKAAGFTEDEHGTLWNGIVTKMYLDLKGKYWWVSMKREIAEFVALCDV
CQRVKAEHQRPAGLLQPLQVPEWKWDEIGMDFITGLPKSQGGYDSIWVVVDRLTKVARFI
PVKTTYGGNKLAELYFARITWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTPLLWD
QVGESQVFGTDILREAEAKVRTIRENLKVAQSRQMSYADNRRRDLEFAVDDFVYLRVTPL
RGVHRFQTKGKLAPRFVGPFRIIARRGEVAYQLELPASLGNVHDVFHVSQLKKCRRVPSE
QADSEQIEVREDLTYVERPVKILDAMERSTRNRVIRFCKVQWSNHAEEEATWEPIPISSS
VLPNLGVEIPFKGVGLSRPKTTLKYIP
Download sequence
Identical sequences Q7XS93
LOC_Os04g06110.1|13104.m00532|protein 39947.LOC_Os04g06110.1 LOC_Os04g06110.1|PACid:21893604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]