SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g12310.1|PACid:21896553 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g12310.1|PACid:21896553
Domain Number 1 Region: 813-1132
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.22e-114
Family Reverse transcriptase 0.0005
Further Details:      
 
Domain Number 2 Region: 1302-1460
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.61e-42
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 667-774
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000996
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number 4 Region: 606-641
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000436
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g12310.1|PACid:21896553
Sequence length 1625
Sequence
MVRCGGLCYARGIVTAPFRAPGLEWYIPGLEIELCSRDGCSEWLGLYNRMPRYKPEYLFG
VEGFVQELRTMSFVIGFGTAPFYAQIPHDRHEEKCRVKVTLNSNSEDIPSVMFEAGGRNY
IHACQEVARIAIGELRDRYSDQLADTEYRYHPRQPQGSDRGSYLETEGIENDATTRHLVE
MLWAMDETRAESVLAAQDREDQNRGKICKLEGKVDRLEKELAALKGEAPPLKARVRLTAR
KRALFVPRYQLAPKVRVVEKEVTPAVADPPVIIISDDEEEESKRTHSKIEWGATQVFPRF
LFLCSCPCQMVLTRSNGNGPNNNNNNNNNGENPTLAQVLAQQAQLMNMMMQQLQNQQNQG
NNQAPPQNKLVEFLRVRPPTFSSTTNPVEAGDWLHAIEKKLDLLQCTDQEKVSFASHQLH
GPTSEWWDHFRLNRTTAEPITWLEFTAAFRKTHIPSGVVSLKKKEFRSLTQGSRSVTEYL
HEFNRLARYAPEDVRNDEERQEKFLEGLNDELSCPLMTGDYPDFQKLVDKAIRQEDKYNR
MEQKKRQIAQFKAQQGNSQRPRLTLGPQSMPQGGSSSVVRPQRQFFNNNAGNNIRNQAPR
PVAASTQQQPAKREQGSKPVVCFNCGDPGHYADKCPKPRRVKVVPAQSNSTVPASKARVN
HVAAAEAQDAPDVILGTFLVNSVPATVLFDSGATHSFVSMSFAGNDGMEVEDLRRHLMVS
TPSNQALSLQRSPFVRIEIQGVPFLANLILLESKDLDVILGMDWLARHKGVIDCANRKVT
LTSNDGRVVTVHALSSESLRSRLNQITLEEIPVVREYPDVFPDDLPGMPPKRDIEFRIDL
VSGTTPIHKRPYRMAANELAEVKRQVDDLLQKGYIRPSSSPWGAPLKGATVFSKIDLRSG
YHPLRIKQEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNKVFMEYLDKFVVVFID
DILIYSRTKEEHEEHLRLALEKLREHQLFAKFSKCEFWLSEVKFLGHVISAGGVAVDPSN
VEFVTNWKQPKTVSEIRSFLGLAGCVLMQDGKVVAYASRQLRPHEKNYPTHDLELAAVVH
ALKIWRHYLFGTRTEVYTDHKSLKYIFTQPDLNMRQRRWLELIKDYDLGIHYHPGKANVV
ADALSRKGYCNVTEGRQLPLQLCKEFERLNLGIVSRGFVAALEAKPTLIDQVREAQINDP
DILEIKKNMRRGKAIGFLEDEQGTVWLGERICVPDNKDLKDAILKEAHDTLYSIHPGSTK
MYQDLKERFWWASMKREIAEYVAVCDICQRVKAEHQKHAGLLQPEWKWEEIGMDFITGLP
RTSSGHDSIWVIVDRLTKVARFIPVKTTYSGSRLAELYMARIVCLHGVAKKIVSDRGSQF
TSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACALDFGGSWDKNLPYAE
FSYNNSYQASLQMAPYEALYGRKCRTPLLWDQTGERQVFGTDILREAEEKVKIIQERLRV
VQSCHKSYADYRRRDLCFDEGDYVYLRVTPLRGVHRFHTKGKLAPRFVGPYKIVSRRGEV
AYQLELPQSLAGVHNVFHGSRAGRSSAGLVFLNLVFFLGAGADVSIADDLVFLFLPASAG
SLMSP
Download sequence
Identical sequences Q7XR40
LOC_Os04g12310.1|PACid:21896553 LOC_Os04g12310.1|13104.m01129|protein 39947.LOC_Os04g12310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]