SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g38180.1|PACid:21893098 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g38180.1|PACid:21893098
Domain Number 1 Region: 797-1155
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.78e-127
Family Reverse transcriptase 0.00056
Further Details:      
 
Domain Number 2 Region: 1327-1487
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-42
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 653-757
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000277
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number 4 Region: 589-626
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000153
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g38180.1|PACid:21893098
Domain Number - Region: 1538-1617
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000214
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g38180.1|PACid:21893098
Sequence length 1635
Sequence
MSWHRAGVLLLGAQSCLPVPGVPAVGGIGSVLLSMARMGWKLCHVFRLYTVVMAGSINRR
GLDLTGFVLELRGMCVVLGYAHGVDYQGRQLPEQEGDDAEPHAAWEVTAVILTGSPERTS
LAVTTGGDSFSAACQNAALLAIGTLHQRYPDELQHSPYRYHPRRGGARDYATFRDASSED
DATIMHLARMVEAYDAARIDFHQMLKKDLDAAEAQLHQLKIAQGEVCRPKRRRVCRSQKI
TARKSTSRPELVRQSLAWTCFVETPRAEPAPMAPQEGEASGVDGDDQEKCCYGEGSHPEG
SNHNNQGSPPPPPPPPLPPPPDTNAILTQILAQQANMMAALLHHIQNPPQHNAPPPPPQH
SKLAEFLRIRPPTFSSSNNPVDALDWLHAVGKKLDTVQCSDEEKATQPEGQPITWARFTA
AFRRTHVPAGVMALKKREFRELKQGNRSVMEYLHEFNNLARYAPEDVREDEEKQKKFLAG
MDPELSVCLVSGDYPDFQRLVDKSIRLEAKHKELESHKRRLANFRNQQGANQRIRYTNPY
PGGSSSQQQKQQQPRSAPRPQFVVCVPQPQQQQSQQGTRAPRPPTPAAQSGQGRRDVQGP
QRLCFNCFEPGHFADKCPKPRRQQGQAPPRSNNGGKDVIRGRVNHVTAEDVLTTPDVIVG
TFLIHSIPATILFDSGASHSFISVPFVGRNQLGVERLRNPLLITTPGGVMTAKYYSPAVP
IEIQGIPFPSDLILLDTKNLDVILGMNWLAQFQGVVDCARRTVTLYRGPEQPVVFFAPPT
SVSSSELHQIGLSEIPIVREFGDVFPEELPGMPPKREIEFWIDLAPGTTPLYKRPYRMAA
NELAEVKKQLEELKEKGYIRPSTSPWGAPVIFVEKKDKTKRMCVDYRALNEVTIKNKYPL
PRIDDLFDQLKGATVFSKIDLRSGYHQLRIREEDIPKTAFTTRYGLHEFTVMSFGLTNAP
AFFMNLMNKVFMEYLDKFVVVFIDDILVYSQSEEDHQHHLRLVLGKLREHQLYAKLSKFV
EERREICVEPAMREGVQEKLVSSPVLILPDTRKDFMVYCDASRQGLGCVLMQEGHVVAYA
LRQLRPHEGNYPTHDLELAAVVHALKIWRHYLIGNRYEIYTDHKSLKYIFNQSDLNLRQR
RWLELIKDYDVGIHYHPGKANVVADALSRKSHCNTLNVRGIPPELNQQMEALNLSIVGRG
FLAALEAKPTLLDQIREAQKNDPDMRGLLKNMKQGKAAGFTEDEHGTLWNGNRVCVPDNR
ELKQLILQEAHESPYSIHPGSTKMYLDLKEKYWWVSMKREIAEFVALCDVCQRVKAEHQR
PAGLLQPLQVPEWKWDEIGMDFITGLPKTQGGYDSIWVVVDRLTKVARFIPVKTTYGGNK
LAELYFARIVSLHGVPKKIVSDRGSQFTSHFWKKLQEEMDTRLNFSTAYHPQTDGQTERL
NQILEDMLRACVLDFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTPLLWDLV
GENQVFGTDILREAEAKVIIARRGEVAYQLDLPASLGNVHDVFDVSQLKKCLRVPSEQAD
SEQIEVREDLTYVERPVKILDTMERGTRNRVIRFCKVQWSNHAEEEATWEREDELKAAHP
DLFASSSESRGRNSV
Download sequence
Identical sequences Q7X693
39947.LOC_Os04g38180.1 LOC_Os04g38180.1|13104.m03661|protein LOC_Os04g38180.1|PACid:21893098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]