SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g45400.1|PACid:21895621 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g45400.1|PACid:21895621
Domain Number 1 Region: 829-1258
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-178
Family Reverse transcriptase 0.0000161
Further Details:      
 
Domain Number 2 Region: 1431-1590
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-42
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Domain Number 3 Region: 685-789
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000236
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number 4 Region: 622-658
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000335
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g45400.1|PACid:21895621
Domain Number - Region: 1702-1781
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000102
Family Chromo domain 0.013
Further Details:      
 
Domain Number - Region: 320-332,429-434
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000314
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g45400.1|PACid:21895621
Sequence length 1799
Sequence
MSWHRAGVLLLGAQSCLPVLGVPAVGGIGSVLLSMARMGWKLCHVFRLYTVVMAGSVTRR
GLDMTGFVLELRGMCVALGYPHGVDYQARPLPEQEGDDAEPHAAWEVTAVILAGSPERTS
LTVTAGGDSFPAACQSAALLAIGTLHQRYPDELQHSPYRYHPRRGGARDHTTFRDASSED
DATIVHLARMVEAYDAARIDFHQMVRRGMVEDNLKILELRQENLQLKKDLDAVEAQLHQL
KIAQGEICRPKRRRVCRSLKITARKSTSRPELVRQSLAWTCFVETPRAEPAPVMVMTRRS
ANTGDGNQPEGSNHNHQGNPPPPPPLPPPPPPDTNAILTQILAQQANMMTAFLHHLQNPP
QLNAPPPPPQHSKLAEFLRIRPPTFSSSNNPVDALDWLHAVGKKLDTVQCSDEEKVIFAA
HQLQGPASLWWDHFQATQPEGQPITWARFTAAFRRTHVPAGVVALKKREFREWKQGNRSV
MEYLHEFNNLARYAPEDVREDEEKQEKFLAGMDPELSVRLVSGDYPDFQRLVDKSIRLEA
KHKELESHKRRLANFRNQQGANQRVRYTNPYPGGSSSQQQQQQQQPRSAPRPQFVVRVPQ
PQQQQNQQGTRAPRPPPPTVQPGQGRRDAQGPQRLCFNCFEPGHFADKCPKPRRQQGQAP
PRPNNGVKDVIRGRVNHVTAEDVLTTPDVIVGTFLIHSIPATILFDSGASHSFISVPFVG
RNQLGVERLRNPLLITTPGGVMTAKYYIPAVPIEIQGIPFPSDLILLDTKNLDVILGMNW
LAQFQGVVDCARRTVTLYRGPEQPVVFFAPPTSVRSSELHQIELSEIPIVREFGDVFPEE
LPGMPPKREIEFRIDLAPGTAPLYERPYRMAANELAEVKKQLEELKEKGYIRPSTSPWGA
PVIFVEKKDKTKRMCVDYRALNEVTIKNKYPLPRIDDLFDQLKGATVFSKIDLRSGYHQL
RIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNKVFMEYLDKFVVVFIDDILI
YSQSEEDHQHHLRLVLGKLREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAV
TDWKQPKTVTQVRSFLGLAGYYRRFIENFSKIARPMTQLLKKEEKFVWSPQCEKAFQTLK
EKLVSSPVLILPDTHKDFMVYCDASRQGLGCVLMQDGHVVAYASRQLRPHEGNYPTHDLE
LAAVVHALKIWRHYLIGNRCEIYTDHKSLKYIFTQSDLNLRQRRWLELIKDYDVGIHYHP
GKANVVADALSRKSHCNTLNVRGIPPELNQQMEALNLSIVSRGFLAALEAKPTLLDQIRE
AQKNDPDMHGLLKNMKQGKAAGFTEDEHGTLWNGNRVCVPDNRELKQLILQEAHESPYSI
HPGSTKIYLDLKEKYWWVSMKREIAEFVALCDVCQRVKAEHQRPAGLLQPLQVLEWKWDE
IGMDFITGLPKTQGGYDSIWVVVDRLTKVARFIPVKTTYGGNKLAELYFARIVSLHGVPK
KIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVLDFGK
TWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTPLMWDQVGESQVFGTDILREAEAK
VRTIRDNPKVAQSRQKSYADNRRRDLEFAVDDFVYLRVTPLRGVHRFRTKGKLAPRYVGP
FRIVARRGEVAYQLELPASLGNVHDVFHGSQLKKCLRVPSEQADSEQIEVREDLTYVERP
VKILDTMERRTRNRVIRFCKVQWSNHAEEEATWEREDELKAAHPDLFASSSESRGRDSV
Download sequence
Identical sequences Q7XU11
LOC_Os04g45400.1|PACid:21895621 39947.LOC_Os04g45400.1 LOC_Os04g45400.1|13104.m04554|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]