SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g15030.1|PACid:21941599 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g15030.1|PACid:21941599
Domain Number 1 Region: 496-752
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.45e-83
Family Reverse transcriptase 0.0021
Further Details:      
 
Domain Number 2 Region: 858-1015
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-41
Family Retroviral integrase, catalytic domain 0.046
Further Details:      
 
Domain Number 3 Region: 256-295
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000488
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Domain Number 4 Region: 365-457
Classification Level Classification E-value
Superfamily Acid proteases 0.00000175
Family Retroviral protease (retropepsin) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g15030.1|PACid:21941599
Sequence length 1154
Sequence
MAGRTATTAALGYMVLGLYRRREAKARVAAGFLGCYKDDGHQRHCARNGEREDRFGKLKV
TIPKFCGTNDPEEYLTWEFKVDKIFRMRNYTEETKLHMASLEFDEYALIWWEQMLNQREE
HDELAVATWVEMKHEMRARFVPSHYKRDLFERLQNMRQGTRSVEEYYKEMEKAMIRAKIY
NTIVQLVHQATKAEHQVQEDAKVAHNTSFTTRSLSSGGRPTPKFNLSKNFISSNSPSLNL
ASKKEESTQSASKKFVVPTGSSTSSVGSTPKSSNIQCFKCLGRGHMQKDCPNNKTMLILE
DGEYESTSEDKDDLAADLTHFDDAQEEDEENGVVYYDFEEGPSLVVTPKVLTVQPKIDHE
QRCNLFQTKAKVDGKVCKVIIDGGSCHSLASKEICNKLGLNLVRHPHPYHVQWFSDCGEV
KIQFMVQVTFQIGDYCDTVECDVVPMTVCHLLLGRPWQYDRAAQHDGRTNQYKLRWKEKD
IVLRPMTPSQIINENCQKLEVVVQSDKKREQKIVIHKSKDGTWRMCVDCRAINSISVRYR
HPIPRLDDMLDELSGAVIFSKIDLRSGYHQIRMKEGDEWKIAFKTKFGLYEWLVMPFGLT
NAPSTFMRLMNHVLRAFIGKFVVVYFDDILIYSKTMEEHLAHIRQVLEMLRSERLFANFE
KCTFCREKEGKPIAYFSEKLGSAQLNYPVYDKELYALVRALETWQHYLWPKEFVIHSNHE
ALKYLRGQANLNRRHAKWVEFIESFPYIVRYKKGKENVVADALSRKSVLLTQLDVKVSSL
ESLKELYSKDSEFSDPYSKCLDGKGWEKYHVHDGFLFRADKLCVPESSLRHDVERYVQRC
VTSHKAKSKLNPHGLYTPLPVPNAPWEDISMDFVLGLPRTRRGRDSIFVAVDRFSKMAHF
IPCNKSDDASHVADLFFREVVRLHGVPRTIVSDRDVKFMSYFWKTLWAKLGTKLLFSTTC
HSQIDGQMEVVNRTLSMLLRMMIKKNLKEWEDCLPHVEFAYNRVVHSTTQLSPFEVVYGF
NPITPLDLLPLPLQERANMEATKRADYVKKMHEKTKETIERIIQSYAAKANKDRKKMLFQ
PGELVWVHLRKDRFPEKRKSKLMPHGDGPFRVLEKITDNAYKIDLPGDYTVSNTFNVVDL
SPFFGTEETDSRTI
Download sequence
Identical sequences Q60ET2
LOC_Os05g15030.1|13105.m01578|protein 39947.LOC_Os05g15030.1 LOC_Os05g15030.1|PACid:21941599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]