SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g18340.1|PACid:21943219 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g18340.1|PACid:21943219
Domain Number 1 Region: 515-944
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.78e-173
Family Reverse transcriptase 0.0000156
Further Details:      
 
Domain Number 2 Region: 369-476
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000156
Family Retroviral protease (retropepsin) 0.047
Further Details:      
 
Domain Number 3 Region: 306-344
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000209
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 
Domain Number 4 Region: 1111-1175
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000569
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g18340.1|PACid:21943219
Sequence length 1358
Sequence
MVNTRTGTGSGSGSGSGSGATNNGGDPTLAQILAQQTQLINLLVQQAQNQQGNNQNQNPP
PPPQNKLADFLHVRPPTFSSTTNPVEAGDWLHAVEKKLDLIQCTEQEKVSFASHQLHGPA
AEWWDHFRQGRAEGEPITWQEFTAAFKKTHIPSGVVALKKREFRALNQGSRSVTEYLHDF
NRLARYAPEDVRTDEERQEKFLEGLNDELSYALMSTDFRDFQQLVDKAIRQEDKYNRMEQ
KKRRAAQFKAQQGSNQRPRLVTGPQAPSYPQGGSSSVVRPQRQFYNNNTGNRGNDNRNMV
VHPAATSAQNQPVRKEQGSKTVTCFNCGDLGHYADKCPKPRRVKNVPAPNNSNVPAPKAR
VNHVAAAEAQNAPDVVLGTFPVNSIPATVLFDSGATHSFLSKSFASNHGMEVISLGRPLL
VNTPGNQAFSTQYCPSATIGIEEDPFPSSLILLESKDLDVILGMDWLSRHRGVIDCANRK
VTLTSSNGETVSFFVSSPKSHGVTINQVALQDIPIVRDYSDVFPEDLPGMPPKIDIEFRI
DLVPGTNPIHKRPYRMAANELAEVKRQVEDLLQKGYIRPSTSPWGAPVIFVEKKDHTQRM
CVDYRALNEVTIKNKYPLPRIDDLFDQLEGATVFSKIDLRSGYHQLRIREEDIPKTAFTT
RYGLFECTDMSFGLTNASAFFMNLMNKVFMEYLDKFVVVFIDDILIYSKTKEEHEEHLRL
ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISSGGVAVDPSNVESVLSWKQPKTVSEIRS
FLGLAGYYRRFIENFSKIARPMTRLLQKEVKYKWTEDCERSFQELKKRLVTAPVLILPDS
RKGFQVYCDASRLGLGCVLMQEGKVVAYASRQLRSHENNYPTHDLELAAVVHALKIWRHY
LFGNRTEVYTDHKSLKYIFTQPDLNMRQRRWLELIKDYDMEIHYHPGKANVVADALSRKS
YCNMSEGRRLPRELCQEFEKLNLGIVSKGFVAALEAKPTLFDQVREAQVNDPDIQEIKKN
MRRGKAIGFVEDEQGTVWLGERICVPENKELKDTIMKEAHETLYSIHPGSTKMYQDLKQQ
FWWASMRREIAEYVALCDVCQRVKAEHQKPADGQTERVNQILEDMLRACVLDFGGSWDKN
LPYAEFSYNNSYQASLQMAPYEALYGRKCRTPLLWDQTGERQVFGTDILREAEEKVKIIQ
ERLRVAQSRQKSYADNRRRDLAFEEGDYVYLRVTPLRGVHRFQTKGKLAPRFVGPFKIVS
RRGELAYQLELPPSMAGIHDVFHVSQLKKCLRIPTEEADPDRIELQEDLTYVEKPVRILE
FPTFRRRAFPLRKVPKRLRKPKASHTDLKQPFEHVDPV
Download sequence
Identical sequences LOC_Os05g18340.1|PACid:21943219 LOC_Os05g18340.1|13105.m01936|protein 39947.LOC_Os05g18340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]