SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g27920.1|PACid:21938821 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g27920.1|PACid:21938821
Domain Number 1 Region: 125-225
Classification Level Classification E-value
Superfamily PX domain 7.19e-22
Family PX domain 0.0039
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g27920.1|PACid:21938821
Domain Number - Region: 299-354,382-525
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000173
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g27920.1|PACid:21938821
Sequence length 540
Sequence
MMSSTAPPDMPAGDGDGDMETLPLASDYASVASTFDPLLSSAAAAASPPSPTIAAAAAFP
LSPSSSSSFVDPPSYADVAASSSSSPRSASASASASPRSAASDYALIAVSDPTPEAEPAA
TSLVPGSAPTYISYLVTSARRGDHRRHAVRRRFRDFVTLADRLAEAFRGHFVPPRPDKNT
VESQVMQRDEFVAQRRAALERYLWRLAEHPAIGPSDELRVFLQAEGKMPLPSTTDVASRM
LDGAARLPRQLLAGEEAVAAPQEVVQPAKGGRDLLRIFKELKQSVVSDWGGVRPPLVEED
KEFLDKKQKLQDWEQQLTSASQQAEALVKAQQDMGETMGALGLAFIKLTKFETEEAMYDS
QRIRAADSKRIATAAVKASRACRDLNTQTVKYLDTLHEHLGIMLSVHTAFSDRSSALLTV
QTLMSDLASLQLRIEKLEAAASKIFGGDKSRLRKVEELRETIRATEDAKCCALREYERIK
ENNRSELNRLDREKKEDMLEMIKGYVTSQAAYAEKIVEGWETVAEETSGYARRSDNNIAW
Download sequence
Identical sequences A0A0E0PL20 Q5W6R5
LOC_Os05g27920.1|PACid:21938821 XP_015639649.1.37577 XP_015639650.1.37577 LOC_Os05g27920.1|13105.m02869|protein 39947.LOC_Os05g27920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]