SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g35390.1|PACid:21942350 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g35390.1|PACid:21942350
Domain Number 1 Region: 766-1118
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-148
Family Reverse transcriptase 0.0000411
Further Details:      
 
Domain Number 2 Region: 1290-1447
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.49e-44
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 612-717
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000214
Family Retroviral protease (retropepsin) 0.037
Further Details:      
 
Domain Number 4 Region: 525-562
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000192
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g35390.1|PACid:21942350
Domain Number - Region: 1572-1605
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000102
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g35390.1|PACid:21942350
Sequence length 1607
Sequence
MVELSEAQATQHDLLLEAYRSLARRYAALEACLAEEGVTSVDTISWDSGRLCHASHLSSH
SSRGSALTPSGPRSPSSRAPYSPVYSPYPHPVSPSYTPGHTPVASSRRGPRFIRTARKRV
VGSSNVFRFHYPAPPPPAARAAAGPRQMASRPRRAARAPARFGFEDGRVEPEENHESANE
QSHHSNRSHRTVSRNAEVEQPRHSSRSHRTVSRDAEMEQSHRSHRTASHNSGEERLPSPP
HVETNMQHLMAVQTQILQGLTTAIASFQHNAHGNGHPHMGNNRSKLTDFLRSRPPEFSQT
VEPVEADDWLKDVDRKLNLVQCTPVEKTLYASHQLRGPAADWWENYCNAHPEPTNIAWDE
FATAFRAAHVPESTIDMKKEEFNRLKQGNSSVNEYLSQFNKLARYAPEEVDTDKKKIRKF
LKGIAVGMRLQLLAHDFPTFQHMINKALLLEDARKEATEEYKKRKSNHQGNSSRGAPRPR
YGQPMQYHQSVTQANRQPGYAPRPQINRPAPQPQQRAPSSDTAPNSVTSFKSPQGPSAVQ
CFRCNQMGHYARQCPQNPTNTNSGHANGSTARTPTLAAAQSRPSSQASGQGSRASNNFGR
GRVNHIQAETTQDAPDVVMGMFSVNSVPAIVLFDSGASHSFISQAFVKRNGWKTQNLRVP
MIVHSPGRNIRATQICPEVNLRIEEVDFLAKPIVLDSQSLDIILGMDWLAKHKGQIDCAE
KSITLQGPGGKQVRFTPNTPTASRSILTCLQVTSLESVPIVYEYPDKKDGSERMVIDYRA
LNEVTIKNKYPLPRIDDLFDQLKGARVFSKIDLRSGYHQLKIRSEDIPKTAFSTRYGLYE
FTVMSFGLTNAPAFFMNLMNKIFMEYLDQFVMVFIDDILIYSKNKEEHAEHLRLIMEKLR
DHQLFAKFSKCEFWLDRVAFLGHVISSNGVEVDPNKVEAVLAWNPPKNVSEIRSFLGLAG
YYRRFIEGFSKLARPMTELLKKEKKFQWSAACEDSFQELKKRLTTAPVLTLPDIRKDFEI
FCDASRQGLGCVLMQEQKVVAYASRQLRPHEANYPTHDLELAAVVHALKIWRHYLIGNRC
EVYTDHKSLKYIFTQTELNMRQRRWLELIKDYDLGIHYHPGKANVVADALSRKAYCNVAQ
IRPDQDHLCRELEKLRLTVVQSGVPASLTIQPTLESQIREAQKDDEGIKELIKRIQEKKD
TNFSIDDQGTVWCGPRICVPAKKELRDLILKEAHESAYSIHPGSTKMYQDIKAYFWWAGM
KRDVAEYVALCDICQRVKAEHQRPAGLLQPLPIPEWKWEEIGMDFITGLPRTPNGYDSIW
VIVDRLTKSAHFVPVKTSYDGKKLAELYMTHVVCRFGCPKKIVSDRGTQFTSRFWKQLHE
ALGTDLNFSTAYHPQTDGQTERVNQILEDMLRACALDFEGTWDRCLPYAEFSYNNSYQAS
IQMSPNEAMFGRKCRTPLCWNEVGKALVFGPDILKSAEEQVKLIRERLKTAQNRQKNYAD
NRRRDLEFEKGDHVWRSCVPAGITPPWYEKLKKCLRVPEEQVPLGNIELEKNLTYKERPI
KVLEEAERQTRRKTIKFYKVQWSNHSEDEATWEREDLLRAEFPDLLP
Download sequence
Identical sequences 39947.LOC_Os05g35390.1 LOC_Os05g35390.1|13105.m03705|protein LOC_Os05g35390.1|PACid:21942350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]