SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g08070.1|PACid:21931740 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os06g08070.1|PACid:21931740
Domain Number - Region: 708-731
Classification Level Classification E-value
Superfamily PH domain-like 0.0399
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g08070.1|PACid:21931740
Sequence length 1336
Sequence
MAAPATLAPCSCHRGTRAVVEMDRLVRVYYGGRVVEPYVGAHVEFEDMSLKTILFPTHPT
LDELRSRVKEVLGWTEDNVEIRFYGRYDVGQGHKYILNVIGQLEWEVYFDLVKESQFRSL
EVFASKLVRTVENLDLNKSSSYHYVEKNFVTYYSRRGGGASKTELSSYGVNPEYPTEVAG
QYVNPDDYFDVELSGGHDSVSVEVNRDDVDEEASVEQYDVEFAEDSDDDRPFPPLTNNDK
LALEECRAFEKVFGRKPDIPEFRDLTHAHGTLLDGGINLYQLPKPFQVDGLRKGLEFPSM
VALKLWFQDYAIVHHRPYRVVNSAANRRYTVKCENPRCKWKVHATKRSSGTWRISRCFRP
SIEAFKHCRPVLAIDATFLTGKYGGALMTALSADAEDQLVPLAFALVEKENSRDWCWFIN
LVRRVVVGPHREVCIISDRHASIMNAMTTPVPGLPPVHHRWCMRHFSANFHKAGADKHQT
KELLRICQIDEKWIFERDVEALRQRIPEGPRKWLEDELLDKDKWSRAYDRNGRRWGYMTT
NMAEQFNSVLVGVRKLPVTAIVSFTFMKCNDYFVNRHDEALKRVQLGQRWSTKVDSKMKK
KTYEVTERGGITRGGVRFGVRAFKVEGEGNSCSCQRPLLYHMPCSHLIHVYLIHAIDEES
PNRMPYQFSSRAVVNTWASRFEPYLDPTQWPPYDGEEFVADPNLKIKTRGKRRSKWTRVW
VVLEGNHLHAFNLMLRRMAEERQPPTYPALEAYYEARHRGAAIEAGRVLQPLRVRAHAPP
VFDDRYIPYLRAAGLLGVALVVSRGMPVFNAPALTAIVDRWRPETHSFHLPSGEMTITLQ
DVAMILALPLRGHAVTGRTETPGWRAQVEQLFGIPLNIEQGQGGKKKQNGIPLSWLSQNF
SHLDDDAEPWRVECYARAYILHLLGGVLFPDAGGDIASAIWIPLVTNLGDLGRFSWCSAV
LAWTCRQLCEACCRQAPSSNMSGCVLLIQLWIWLRLPVGRPKWRQSFIPWPYNEPDMEKT
VAYLFESTATAHAHRDVAYKHYVNEMDCLQPQHIEWLPYHTNEASSLTLNSMCNRDSDYF
MYDRVRTKKVKDWGLEHNRYIDEWRTAGRNDRTYRLFLHPTWTEADIDDDRDSDEGRNPY
DVRTRVGYQMEHAPLRDRVSRELLRSVNEMGHALQAPRGGEDTENTLRNVLEKVRQRGRN
PRNTTCDPLGQRKRGTLRARKLFDANGRSDLYEVNLFVGRRQRAAPTTLAPRLGRAAPAS
AARQKGFGLGEGGASRGPEAEGLRWGEEGGTSHPGAAVWGGASRCPEAEAKILRGGGRKL
VGPAEEGRASHAGAVV
Download sequence
Identical sequences LOC_Os06g08070.1|13106.m00843|protein LOC_Os06g08070.1|PACid:21931740 39947.LOC_Os06g08070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]