SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g09610.1|PACid:21928875 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g09610.1|PACid:21928875
Domain Number 1 Region: 120-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-52
Family Glutathione peroxidase-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g09610.1|PACid:21928875
Sequence length 265
Sequence
MAFAVSTACRPSLLLPPRQRSSPPRPRPLLCTPSTAAFRRGALSATTTPTPARAALPSTT
GRNRIVCGKVTTTNNYPSSCRSRRSTMMHAAAWLLLQQLSPAAARVARAADDDSSVQVSK
GSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAE
VIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGV
VQYIYNNQFQPEKHIGETLKILQSL
Download sequence
Identical sequences A0A0E0PUN2
39946.BGIOSIBCE020978 39947.LOC_Os06g09610.1 LOC_Os06g09610.1|PACid:21928875 OsIBCD019707 LOC_Os06g09610.1|13106.m01037|protein XP_015641441.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]