SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g13820.2|PACid:21932517 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g13820.2|PACid:21932517
Domain Number 1 Region: 41-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.86e-32
Family G proteins 0.00076
Further Details:      
 
Domain Number 2 Region: 581-701
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-19
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g13820.2|PACid:21932517
Sequence length 911
Sequence
MEAVEELAQLSEAMRQAASLLADDDPSDDSAPRRPSTFLNAVALGNVGAGKSAVLNSLIG
HPVLPTGENGATRAPIVVDLQRDPGLSSKSIVLQIDSKSQQVSASSLRHSLQDRLSKGAS
SGSSRGRVEGINLKLRTSTAPPLKLVDLPGIDQRAVDDSMINEYAGHNDAILLVVIPAMQ
AADVASSRALRLAKDIDADGTRTVGVISKVDQAEGDAKTIACVQALLSNKGPKNLPDIEW
VALIGQSVAIASAQAAGSENSLETAWNAEAETLRSILTGAPKSKLGRIALVDTIAKQIRK
RMKVRLPNLLSGLQGKSQMVQDELARLGESMVQSAEGTRAVALELCREFEDKFLAHITSG
EGSGWKVVASFEGKFPERIKQLPLDRHFDLSNVKRIVLEADGYQPYLISPEKGLRSLIKI
VLDMAKEPSRLCVEEVHRVLLDIVNASANATPGLGRYPPFKREVIAIASNALDSFKNDAK
KMVVALVDMERAFVPPQHFIRLVQRRMERQRREDELKNRSSKKPQDADQPMGKRASSPQT
GSEKDTKDKSAKDKDKDKSGQQDKDAKEGSSVQVAGSSGEITAGYLLKKSAKTNGWSRRW
FVLNEKSGKLGYTKKQEERHFRGVITLEECNLEEVEEEEPPKSLKDSKKANGPEKGPSLV
FKITNRVAYKTVLKAHSAVVLKAESTADKVEWVNKIRAVIQSKGGSFKGPNTDGGSMRQS
NSDGALDTMARRPADPEEELRWMSHEVRGYVEAVLNSLAANVPKAIVLCQVEKAKEDMLN
QLYSSISGQSNAKIEELLQEDHNAKRRREKYQKQSSLLSKLTRQLSVHDNRAASYANDIS
EAESPRTPNRPGEDWRSAFDSASNGPSSGSESRSRSADGRRGRYENGDVTSGANSGSRRT
PNRLPPAPPKY
Download sequence
Identical sequences A2YB92 Q654U5
OsIBCD020016 LOC_Os06g13820.1|PACid:21932516 LOC_Os06g13820.2|PACid:21932517 XP_015643697.1.37577 LOC_Os06g13820.1|13106.m01526|protein LOC_Os06g13820.2|13106.m01527|protein 39946.BGIOSIBCE021325 39947.LOC_Os06g13820.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]